SecReT4
Protein ID: 165932969
T4SS name [ID]VirB [486]
Gene symbolvirD4
Locus tagRrIowa_0470
StrainRickettsia rickettsii str. Iowa
Repliconchromosome [GenBank: NC_010263] [Browse all T4SS(s) in this replicon]
Location [Strand]394958..396733 [+]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDB0BWX6
KEGG IDrrj:RrIowa_0470
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-165, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 8.9e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 1.3e-21, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 2.6e-05, Aligned region: 155..481
Protein Sequence: 591 a.a.     [Download]
>gi|165932969|ref|YP_001649758.1| type IV secretion system component VirD4 [Rickettsia rickettsii str. Iowa]
MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGAFVAIFTNEVGALGVNINAINIAYKWAYWLINVWGQLK
ISDYNYLKLKLLASFLSPAIIVIIFYIKNFERIKSLQFFKQDEKVYGDASWANPSDIEAAGLRSKKGMLI
GVDAGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWE
PSNPDGVTHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNATYRITFAANNYETANLISQLVGNKTVEQRS
FSKPLFFDLNIATRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPT
FVPTQVPFDPRANNNEASEETETITVPENNE
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|319717301|ref|NC_010263.2|:394958-396733 Rickettsia rickettsii str. Iowa chromosome, complete genome
ATGGAATGGCATAAGATACTTAAAGTTACTAGAAATATATTCGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTTGTACCATTTGGATAAGCGGTGCATTTGTTGCAATTTTTACTAATGAGGTTGGAGCTTTAGGTGT
AAATATAAATGCTATAAATATTGCTTATAAGTGGGCTTATTGGCTTATTAACGTTTGGGGGCAGTTAAAA
ATTTCCGACTATAATTATTTAAAATTGAAGCTACTTGCCTCTTTTCTCAGTCCGGCTATTATTGTTATAA
TATTTTACATTAAAAATTTTGAAAGAATAAAATCATTACAATTTTTCAAACAAGATGAAAAAGTATATGG
AGATGCAAGCTGGGCTAATCCGTCAGATATAGAGGCTGCAGGTCTTAGATCTAAGAAAGGTATGCTGATC
GGTGTTGATGCCGGTGGATATTTTGTTGCAGACGGGTTCCAGCATGCTTTATTATTTGCTCCTACCGGTT
CAGGTAAAGGTGTAGGGTTTGTGATACCTAACTTGTTATTTTGGAGTGATTCGGTAGTAGTGCATGACAT
AAAACTTGAAAATCACGGGTTGACAAGTGGTTGGCGTGAGAAGCAAGGGCAGAAAGTTTTTGTATGGGAG
CCTTCTAATCCTGATGGTGTTACTCATTGTTATAATCCGATTGATTGGGTTAGTACTAAGCCTGGGCAAA
TGGTTGATGACGTTCAAAAAATTTCAAATCTTATAATGCCGGAAAAGGATTTTTGGAATAATGAGGCACG
AAGCTTATTTTTAGGCGTAACTCTATATTTAATAGCCGATCCTACTAAAACTAAATCTTTCGGTGAAGTA
GTGCGTACTATGAGGAGTGACGACGTAGTTTATAATCTAGCGGTCGTACTCGATACGCTTGGTGGTGTAA
TACATCCTGTTGCATATATGAATATTGCTGCATTTTTGCAAAAAGCCGATAAAGAGCGTTCCGGCGTAAT
ATCTACAATGAACTCATCGCTTGAATTATGGGCAAATCCACTTATTGATTCAGCTACAGCATCTTCTGAT
TTCAATATACAAGAATTTAAAAAAGTCAAAACAACCGTATATGTAGGGTTAACACCCGATAATATACAGC
GTTTACAAAAATTAATGCAGGTGTTTTATCAGCAGGCGACAGAATTTTTAAGCCGCAAAATGCCGGATTT
AAAGGAAGAGCCGTATGGAGTAATGTTCTTACTTGACGAGTTCCCGACGCTCGGGAAGATGGATACTTTT
AAAGCCGGTATAGCTTATTTTAGAGGTTATAGAGTTCGTTTATTTTTAATTATCCAAGATACACAGCAGT
TAAAAGGAACATATGAAGATGCCGGGATGAATTCTTTCTTATCTAATGCAACATATCGTATTACTTTTGC
CGCTAATAACTATGAAACGGCAAATTTAATATCGCAGCTTGTCGGTAATAAGACGGTAGAACAAAGATCA
TTTAGTAAACCTTTATTTTTTGATCTTAATATTGCTACTAGAACCCAAAACGTTTCTCAGGTTCAAAGAG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCGAGAGATGAGCAAATTGTTTTAATAGAATCCTTTCC
GCCTATAAAATCGCGTAAAATTAAGTATTATGAAGATAAGTTTTTTACTAGTAGATTATTACCGCCGACT
TTTGTACCTACTCAAGTACCTTTTGACCCTAGGGCAAATAATAATGAGGCTTCGGAAGAGACCGAAACAA
TAACTGTTCCGGAAAATAATGAGTAA
 Primer design