SecReT4
Protein ID: 16751941
T4SS name [ID]VirB [381]
Gene symboltraI
Locus tagpIPO2T_p23
StrainPlasmid pIPO2T
Repliconplasmid pIPO2T [GenBank: NC_003213] [Browse all T4SS(s) in this replicon]
Location [Strand]24272..24436 [-]
ProductTraI protein
Component typeVirB7
UniProt IDQ91UX0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 54 a.a.     [Download]
>gi|16751941|ref|NP_444525.1| TraI protein [uncultured bacterium]
MKQAFVVLLVVALAGCATNKAVLPSLEGKPRVKINQQAPVPAAPAPVTNETKGG
 
Nucleotide Sequence: 165 bp     [Download]
>gi|21735067|ref|NC_003213.2|:c24436-24272 Uncultured bacterium plasmid pIPO2T, complete sequence
ATGAAGCAAGCATTCGTCGTCTTGTTGGTCGTCGCCCTCGCGGGCTGCGCGACAAACAAAGCGGTCTTGC
CTTCTCTCGAAGGTAAGCCCCGCGTCAAGATCAATCAGCAAGCGCCCGTTCCTGCGGCTCCTGCACCAGT
CACTAATGAAACCAAAGGGGGGTAA
 Primer design