SecReT4
Protein ID: 16751942
T4SS name [ID]VirB [381]
Gene symboltraJ
Locus tagpIPO2T_p22
StrainPlasmid pIPO2T
Repliconplasmid pIPO2T [GenBank: NC_003213] [Browse all T4SS(s) in this replicon]
Location [Strand]23556..24266 [-]
ProductTraJ protein
Component typeVirB8
UniProt IDQ91UW9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.8e-69, Aligned region: 21..230
Protein Sequence: 236 a.a.     [Download]
>gi|16751942|ref|NP_444526.1| TraJ protein [uncultured bacterium]
MFGKKPGVETPTDEKPVFEQAINWESSRVLSVEKSERRAWRVAFASVGVAVLAIAAIAMMMPLKESVPYV
IRVDNTTGVPDIVTAITDKAVTGDEVMDKYWLAQYVRARETYDWYTLQRDYNTVGLLSSQHVGQGYAQLF
EGKEALDKTYGKTVRATVEILSVVPTGKNTGTVRFIKTTKRVDQEGSPGTVTKWVATVAYEYRSTALIKE
SARLVNPFGFQVLTYRVDPEMVGSTQ
 
Nucleotide Sequence: 711 bp     [Download]
>gi|21735067|ref|NC_003213.2|:c24266-23556 Uncultured bacterium plasmid pIPO2T, complete sequence
ATGTTCGGAAAGAAACCTGGGGTGGAAACGCCCACTGACGAAAAACCTGTCTTCGAGCAGGCGATCAATT
GGGAGTCCTCGCGGGTGCTCTCCGTCGAGAAATCCGAACGCCGGGCATGGCGCGTTGCGTTTGCTTCGGT
GGGCGTTGCCGTCCTGGCGATTGCTGCAATCGCCATGATGATGCCGCTCAAAGAGTCGGTGCCTTATGTC
ATCCGCGTGGACAACACAACGGGCGTTCCTGACATCGTGACGGCCATCACCGACAAAGCCGTGACGGGCG
ATGAGGTCATGGACAAATACTGGCTCGCCCAATATGTGCGCGCCCGCGAAACCTACGACTGGTACACGCT
GCAACGCGACTACAACACGGTCGGCCTGCTGTCCTCGCAGCACGTCGGCCAGGGCTATGCCCAGCTCTTT
GAAGGCAAAGAAGCCCTGGACAAGACCTACGGTAAGACGGTTCGCGCCACGGTTGAAATTCTGAGCGTGG
TTCCTACCGGCAAGAACACCGGAACCGTCCGCTTCATCAAGACGACGAAGCGCGTCGATCAGGAAGGCTC
TCCCGGCACCGTGACGAAGTGGGTCGCCACGGTGGCCTATGAGTACCGCAGCACGGCACTTATCAAGGAA
AGCGCCCGACTGGTGAACCCCTTCGGCTTTCAAGTGCTGACCTATCGCGTTGACCCTGAAATGGTAGGGA
GCACCCAATGA
 Primer design