SecReT4
Protein ID: 16751945
T4SS name [ID]VirB [381]
Gene symboltraM
Locus tagpIPO2T_p19
StrainPlasmid pIPO2T
Repliconplasmid pIPO2T [GenBank: NC_003213] [Browse all T4SS(s) in this replicon]
Location [Strand]20485..21552 [-]
ProductTraM protein
Component typeVirB11
UniProt IDQ91UW6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.2e-65, Aligned region: 26..327
UPF0079 [PF02367], Evalue: 9.4e-05, Aligned region: 167..202
Protein Sequence: 355 a.a.     [Download]
>gi|16751945|ref|NP_444529.1| TraM protein [uncultured bacterium]
MSPRNNSNEYIASVDRAASVNYHLEFAKVWMEDPTITEICVNRPFEVFCERQNVWERHEVPGLTLDHLLS
LATATAKFSSNDVSENRPILSAIMPGGERVQIVLPPACEHGTVSVTIRKPSFNVRTLGDYDKQGFFKHIK
PLTSDLTEQETELVRLKEDGNYIEFLRRAVQLEKVIVVAGETGSGKTTFMKALMQEIPADQRIITIEDVP
ELFLPSHPNHVHLFYPSEAKEEDNAPVTAAALLKSCLRMKPTRILLAELRSGETFDFINVAASGHGGSIT
SCHAGSCDLTFERLALMVLQNRQGRTLPYSVIRRLLYLVVDVVVHVHNDLTGGAGRHITEVWYDPMMKRA
PAPKE
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|21735067|ref|NC_003213.2|:c21552-20485 Uncultured bacterium plasmid pIPO2T, complete sequence
ATGTCGCCGCGCAATAACAGCAACGAGTACATCGCTTCCGTTGACCGGGCCGCCTCGGTCAATTACCACC
TTGAATTTGCCAAGGTGTGGATGGAAGACCCGACCATCACGGAAATCTGTGTGAACCGGCCGTTTGAGGT
TTTCTGCGAGCGGCAAAACGTATGGGAACGGCACGAAGTGCCGGGCCTGACGCTAGATCACTTGCTGTCG
CTGGCAACAGCCACGGCCAAGTTTTCGAGCAACGACGTTTCGGAAAACCGGCCGATTCTCTCGGCCATCA
TGCCGGGCGGTGAGCGCGTGCAGATCGTGCTGCCGCCCGCCTGCGAACATGGAACGGTGTCGGTCACCAT
TCGTAAGCCGTCGTTCAATGTCCGCACGCTGGGCGACTACGACAAGCAAGGCTTTTTCAAGCACATCAAG
CCGCTGACCAGCGACTTGACGGAGCAAGAAACGGAGTTGGTGCGACTCAAGGAAGACGGCAACTACATCG
AATTCCTGCGCCGCGCCGTCCAGCTCGAAAAGGTCATCGTGGTGGCCGGCGAAACCGGCTCGGGCAAGAC
CACCTTCATGAAAGCCTTGATGCAGGAAATTCCTGCTGACCAGCGCATCATCACGATTGAGGACGTACCC
GAACTGTTCCTGCCAAGCCATCCAAACCACGTCCACCTGTTCTATCCCAGCGAAGCCAAGGAAGAAGATA
ACGCGCCGGTCACGGCCGCCGCGTTGCTGAAAAGCTGCCTGCGAATGAAGCCCACGCGCATCTTGCTTGC
CGAGCTGCGCAGCGGGGAGACATTCGACTTCATCAACGTGGCCGCCTCGGGCCACGGTGGCAGCATCACA
AGCTGCCACGCCGGATCGTGCGACCTGACGTTTGAACGTCTTGCCTTGATGGTCTTGCAGAACCGCCAAG
GCCGCACGCTGCCTTACTCGGTGATTCGTCGGCTGCTGTATCTGGTGGTGGATGTCGTGGTGCACGTCCA
CAACGATCTAACAGGCGGTGCAGGCCGGCACATTACCGAAGTCTGGTATGACCCGATGATGAAGCGCGCG
CCGGCTCCGAAGGAGTAA
 Primer design