SecReT4
Protein ID: 16751946
T4SS name [ID]VirB [381]
Gene symboltraN
Locus tagpIPO2T_p18
StrainPlasmid pIPO2T
Repliconplasmid pIPO2T [GenBank: NC_003213] [Browse all T4SS(s) in this replicon]
Location [Strand]17424..19937 [-]
ProductTraN protein
Component typeVirD4
UniProt IDQ91UW5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.3e-105, Aligned region: 100..579
TraG-D_C [PF12696], Evalue: 1.6e-24, Aligned region: 417..541
TrwB_AAD_bind [PF10412], Evalue: 2.3e-18, Aligned region: 327..555
Protein Sequence: 837 a.a.     [Download]
>gi|16751946|ref|NP_444530.1| TraN protein [uncultured bacterium]
MEMPKWLKWVLGVVVFIAATVGAVWLAGFFFFAFSKTNPFGKTDFSTWWTYWQFYQADPVIAKRLKVSGI
VAAVVAYGAPIVALIAAMREVRSLHGEARFANAGEIEKAGLFGNTGIIIGKLKNRFLMFAGMQFVLLAAP
TRSGKGVGIVVPNLLNFSESAVVLDVKLENFLITSKFRAKHGQEVFLFNPFSKNGQTHRYNPLGYISNDP
RQRVTEILAIGYALYPGGGKDTFFDDAARNLFLGLCLYLCETPALPRTIGELLRQSSGKGQPIKKYLQDL
ITARNFKEETTIGDDGEEVVTLVPIDQWDGQGLPPLSMECVDALNRFTSTSDNTLSSILASFNVPLTIWV
SPLVDAATAANDFDVRDVRKKRMTIYIGIPANKLAEAELLINLFFSQLINLNTDDLLHSKPELKYSCLLL
MDEFAAPGRIGIIDKANAYMAGYGLRLLTIIQSPGQIEAEPRKGYGRESARTLITNHACQIIYTPREQKD
ANEYSEMLGTYTFKAKGSSRQLGGKAAGGRSESESDQKRALLMPQELKEMSQRQQIINLENTKPIKCEKI
AYFQDHVFMDRLKSVAPSLAKLGKKLPTKKQLEDSWGSGECAVDVPYLNLDLHEAVVQARMRELKPADVA
KGIDLRTLALDFSKVPLPEGAGIEPEQVEAFVDGFFDALDAANSYDDSEAPEVDDDGASERPSDDELAAL
DAQAADDDGQEIAVNSVEHADDETPADELVTSSSKPGGASVAKPESHAEPEPVPDHGLGHDQADIEPDGP
TDEDLAAMMEDFTPPDDGVMDEADMLAALDEMEAVPEYVEEAESDAPILDLSVLDKPLPSIKNADRH
 
Nucleotide Sequence: 2514 bp     [Download]
>gi|21735067|ref|NC_003213.2|:c19937-17424 Uncultured bacterium plasmid pIPO2T, complete sequence
ATGGAAATGCCAAAGTGGCTTAAATGGGTGTTGGGCGTGGTGGTGTTCATTGCCGCCACGGTCGGCGCTG
TCTGGCTGGCCGGGTTCTTCTTCTTCGCTTTCAGCAAGACGAACCCGTTCGGCAAAACCGACTTCTCGAC
GTGGTGGACGTACTGGCAGTTTTACCAAGCTGACCCGGTGATTGCGAAGCGGCTCAAGGTGTCGGGCATC
GTGGCCGCCGTGGTGGCCTACGGTGCGCCCATCGTGGCTCTGATCGCCGCCATGCGCGAAGTGCGCTCGC
TGCATGGTGAAGCCCGCTTCGCCAATGCCGGCGAGATTGAAAAGGCCGGGCTGTTCGGCAATACCGGCAT
CATCATCGGCAAGCTGAAAAATCGGTTCTTGATGTTCGCCGGTATGCAGTTCGTCTTGCTGGCCGCGCCG
ACTCGCTCGGGCAAGGGCGTCGGCATCGTCGTGCCGAACCTGCTCAACTTCAGCGAATCGGCCGTTGTCC
TCGATGTGAAGCTGGAAAACTTCCTCATCACATCCAAATTCCGGGCCAAGCACGGCCAGGAAGTGTTTCT
GTTCAACCCGTTTTCCAAGAATGGGCAAACACACCGCTACAACCCGCTGGGCTACATCAGCAATGACCCA
CGGCAGCGGGTGACGGAAATCTTGGCAATCGGCTATGCGCTATATCCGGGCGGCGGCAAGGACACGTTCT
TTGACGACGCGGCCCGAAACCTGTTCCTGGGCCTGTGCCTCTACCTGTGTGAAACGCCGGCATTGCCGCG
CACCATCGGCGAGCTGCTGCGCCAGTCCTCGGGCAAGGGCCAGCCCATCAAAAAGTATCTGCAAGACCTG
ATTACGGCGCGGAATTTCAAGGAAGAAACCACCATTGGCGATGACGGCGAAGAAGTCGTGACGCTGGTTC
CGATTGACCAATGGGACGGCCAAGGCTTGCCGCCGTTGTCAATGGAATGTGTTGATGCGCTGAACCGCTT
CACGTCCACGTCGGACAACACGCTTTCGAGCATCCTGGCATCGTTCAACGTGCCGTTGACCATTTGGGTT
AGTCCGCTGGTTGATGCCGCCACGGCCGCGAACGACTTCGACGTTCGGGACGTGCGCAAGAAGCGCATGA
CGATCTATATCGGCATCCCGGCAAACAAGCTGGCCGAAGCCGAATTGCTGATTAACCTGTTTTTCTCGCA
GTTGATTAACCTCAACACCGACGATCTGCTGCACTCCAAGCCTGAGTTGAAATACTCCTGCCTGCTGCTG
ATGGATGAGTTTGCAGCGCCCGGCCGGATCGGCATCATCGACAAGGCGAACGCCTACATGGCCGGCTATG
GTCTGCGGCTGCTGACCATCATCCAGTCGCCCGGCCAGATCGAGGCCGAACCGCGCAAGGGATACGGCCG
CGAAAGCGCCCGCACGCTGATAACGAACCACGCTTGCCAGATCATCTACACGCCACGGGAGCAAAAGGAC
GCGAACGAGTATTCGGAAATGCTCGGCACCTACACGTTCAAGGCGAAAGGTTCTAGTCGCCAGCTCGGCG
GCAAGGCGGCCGGTGGTCGAAGCGAATCCGAGTCGGATCAAAAGCGGGCGCTGCTCATGCCGCAAGAACT
CAAGGAAATGAGTCAGCGGCAACAGATCATCAACCTTGAAAACACCAAGCCCATCAAGTGCGAAAAGATC
GCGTACTTTCAGGATCACGTTTTCATGGATCGCCTCAAGTCGGTTGCGCCGTCGCTGGCGAAGCTCGGCA
AGAAACTGCCGACGAAAAAGCAGCTTGAAGACTCTTGGGGTTCCGGGGAATGCGCTGTCGATGTGCCGTA
CCTGAACCTTGATCTGCATGAAGCTGTCGTGCAGGCCCGCATGCGCGAGTTGAAGCCGGCCGACGTGGCG
AAGGGCATCGACCTTCGCACGCTGGCCCTGGACTTCTCCAAGGTGCCATTGCCCGAAGGTGCCGGCATCG
AGCCGGAACAGGTGGAAGCCTTCGTTGACGGCTTCTTTGATGCCCTGGACGCGGCCAACAGCTACGACGA
CAGCGAAGCGCCGGAAGTTGATGACGACGGGGCCAGCGAACGCCCTAGCGATGACGAACTGGCGGCACTG
GACGCCCAGGCGGCCGATGACGACGGGCAGGAAATCGCGGTGAATAGCGTTGAGCATGCCGACGACGAAA
CGCCTGCCGATGAATTGGTGACAAGTTCATCGAAGCCTGGCGGCGCTTCTGTCGCCAAGCCTGAGTCGCA
CGCGGAACCTGAACCCGTGCCGGATCACGGCCTTGGTCATGACCAAGCCGACATTGAACCGGACGGGCCT
ACGGACGAAGACCTTGCCGCAATGATGGAAGACTTCACGCCACCCGATGACGGGGTGATGGATGAAGCCG
ACATGCTGGCCGCGTTGGATGAAATGGAAGCGGTGCCGGAATATGTCGAGGAAGCCGAAAGCGACGCGCC
AATACTCGATTTGAGCGTGCTTGACAAGCCCCTTCCTTCAATCAAAAATGCGGATAGGCATTGA
 Primer design