SecReT4
Protein ID: 167621638
T4SS name [ID]Trb [468]
Gene symbol-
Locus tagCaul_5368
StrainCaulobacter sp. K31
Repliconplasmid pCAUL02 [GenBank: NC_010333] [Browse all T4SS(s) in this replicon]
Location [Strand]78935..79972 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB0T9T8
KEGG IDcak:Caul_5368
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.1e-56, Aligned region: 120..340
Protein Sequence: 345 a.a.     [Download]
>gi|167621638|ref|YP_001672146.1| P-type conjugative transfer protein TrbG [Caulobacter sp. K31]
MSAMRDRSLRAWGAPGRVGGLVIVLAMAGGGAVLAQAGAPQSVTASSVIPAPASRSAPAGAVTTTTTTSV
APIANAAAPRRPQRRSAPRTYARPGPLSTVQSANSSARDYPTSGAYINSALYYDFEPGRLYTVHASPHFL
TAITLRPGEKLISKAAGDTIRWVLGETVQGAGASQQVIVMVKPIRGNLRTNIILTTDQRTYLLDARSYEG
DTYTSVISWNYPQEEMRDAQAARAAEAQSVVASGLAIDRLHFGYDVRTIHSRKPSWQPIRVFDDGLKTYI
QFPTNMAATQAPPLFLIGADKQVQLVNYRYLGGYYIVDRMIDVAELRLGEKNQTVVRITRTRDRG
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|167621562|ref|NC_010333.1|:c79972-78935 Caulobacter sp. K31 plasmid pCAUL02, complete sequence
ATGAGCGCCATGAGAGATAGATCCCTCCGAGCCTGGGGCGCGCCCGGTCGGGTGGGCGGCCTGGTGATCG
TTCTGGCGATGGCCGGCGGCGGCGCGGTTCTGGCGCAGGCCGGGGCGCCGCAATCGGTGACGGCCTCGTC
GGTCATCCCGGCGCCCGCCTCACGCTCCGCGCCAGCCGGCGCGGTCACCACGACGACGACCACGAGCGTC
GCGCCGATCGCCAACGCGGCGGCGCCCAGGCGGCCCCAGCGGCGATCGGCGCCGCGGACCTACGCCCGGC
CAGGCCCGCTCAGCACCGTGCAGTCGGCCAACAGCAGCGCGCGCGACTATCCGACCTCCGGCGCCTACAT
CAATTCGGCGCTCTACTACGACTTCGAGCCGGGGCGGCTCTACACCGTCCACGCCAGTCCGCACTTCCTC
ACCGCCATCACCTTGCGGCCGGGCGAGAAGCTGATCTCCAAGGCGGCCGGTGACACCATTCGATGGGTGC
TCGGCGAAACCGTCCAGGGCGCGGGCGCGTCGCAGCAGGTCATCGTGATGGTCAAACCCATTCGCGGGAA
CCTGCGGACCAACATCATCCTGACCACGGACCAGCGGACCTACCTCCTGGATGCCCGCAGCTACGAGGGC
GACACCTATACCAGCGTCATCAGCTGGAACTATCCGCAGGAGGAGATGCGCGACGCCCAGGCGGCCCGCG
CCGCTGAAGCCCAGTCGGTCGTGGCTTCGGGGCTGGCCATCGACCGCTTACATTTCGGCTACGACGTCAG
GACGATCCACTCGCGCAAGCCCAGCTGGCAGCCGATCCGGGTGTTCGACGACGGACTGAAAACCTACATC
CAGTTCCCGACCAATATGGCCGCGACGCAGGCCCCGCCGCTGTTCCTGATCGGGGCCGACAAGCAGGTCC
AGCTGGTCAATTACCGCTACCTGGGCGGCTACTACATCGTGGACCGGATGATCGACGTGGCCGAGTTGCG
GCTCGGAGAGAAGAACCAGACGGTCGTGCGGATCACCCGCACCCGGGATCGGGGCTGA
 Primer design