SecReT4
Protein ID: 167621640
T4SS name [ID]Trb [468]
Gene symbol-
Locus tagCaul_5370
StrainCaulobacter sp. K31
Repliconplasmid pCAUL02 [GenBank: NC_010333] [Browse all T4SS(s) in this replicon]
Location [Strand]80679..81992 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDB0T9U0
KEGG IDcak:Caul_5370
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.1e-39, Aligned region: 39..264
Protein Sequence: 437 a.a.     [Download]
>gi|167621640|ref|YP_001672148.1| P-type conjugative transfer protein TrbL [Caulobacter sp. K31]
MTTADPAALDQFIRAFTGQVGGGFGAIASDVQTVLAILVVISITLTAVLWAIDETQNVLAPLVRKILLIG
FFSWLVTNWHSLSLTVVNGFAKLGLQASGGGSIGDFTKAPTRAVEAGLSVVVDLIKYIGDLAQQNGGFGA
LVHIDMIIVAGVAAIGILLAFIILAIEIAVTIIEFYIVTLIAFVVVPFGVLSQTSFLAERAIGYVISVGF
KFMALAVIAGIGINIFETYTLSAQPTVAEEAGLLLSAIFLMMLSLKVPSIAGALISGGPQLNSGSALMGA
AGVAAGAAGGALAGRAVAGAMGSLAGGGGQVAAARAASGAINSGGSSGGGSSGGGGSPSGSGPAPGSPRS
PASSDASASRAAGGGVSPDGAPPPEPSPSKPSPTSSPGGASLVARAEARRGDGLTSMARNTAAAATAGGD
SQGPGMSATATRRDPEP
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|167621562|ref|NC_010333.1|:c81992-80679 Caulobacter sp. K31 plasmid pCAUL02, complete sequence
ATGACGACCGCCGATCCAGCAGCTTTAGACCAGTTCATCAGAGCATTCACCGGTCAGGTGGGCGGCGGGT
TTGGCGCCATTGCCAGTGATGTTCAGACGGTTCTCGCGATCTTGGTCGTCATCAGCATCACCCTGACGGC
TGTCCTGTGGGCAATCGACGAGACGCAGAACGTCCTCGCGCCTCTTGTGCGGAAGATCCTCCTGATCGGG
TTCTTCTCATGGCTGGTCACAAACTGGCACTCGCTGAGCCTGACCGTCGTCAACGGGTTCGCGAAACTTG
GCCTGCAAGCGAGCGGCGGCGGCTCTATCGGCGACTTCACAAAGGCGCCGACTAGGGCCGTAGAGGCGGG
TCTCAGCGTCGTCGTCGATCTCATCAAATACATCGGCGACTTAGCCCAGCAGAACGGTGGCTTTGGCGCG
CTCGTGCACATTGACATGATCATCGTCGCTGGCGTTGCTGCCATAGGAATCCTGCTCGCCTTCATAATCT
TGGCGATCGAGATCGCTGTCACGATCATCGAATTTTACATCGTGACGCTCATCGCGTTCGTCGTGGTTCC
TTTCGGAGTGCTGTCACAGACGTCCTTCCTCGCAGAAAGGGCGATCGGTTATGTCATTTCTGTTGGCTTC
AAGTTCATGGCCCTCGCGGTCATCGCCGGCATCGGCATCAATATCTTTGAGACCTACACGCTCTCGGCCC
AGCCCACCGTGGCCGAGGAAGCCGGGCTCCTCCTCTCAGCGATCTTCCTGATGATGCTTTCTCTCAAAGT
GCCATCCATCGCCGGCGCTTTGATCTCGGGTGGCCCGCAGCTCAACTCGGGTAGCGCTCTGATGGGCGCG
GCCGGTGTGGCGGCCGGTGCTGCCGGCGGGGCCTTGGCCGGTCGCGCGGTCGCTGGAGCCATGGGCAGTT
TGGCGGGCGGCGGGGGGCAAGTCGCTGCGGCTCGCGCCGCGTCCGGGGCGATCAACTCAGGCGGTTCAAG
TGGCGGCGGCTCGTCGGGCGGCGGCGGTTCTCCGTCAGGGTCCGGGCCGGCTCCAGGGTCCCCCAGATCG
CCAGCCTCCTCAGACGCCTCAGCCAGTCGTGCTGCCGGTGGCGGCGTTTCGCCCGATGGGGCGCCGCCTC
CGGAGCCATCGCCGAGCAAGCCCTCCCCTACGTCTTCCCCTGGCGGCGCCTCCCTCGTGGCCCGCGCCGA
AGCCCGTCGCGGCGATGGCCTGACCAGCATGGCGCGCAACACCGCGGCGGCCGCCACGGCGGGCGGCGAC
AGCCAGGGCCCCGGAATGTCCGCCACGGCGACCCGCCGCGATCCCGAGCCGTAG
 Primer design