SecReT4
Protein ID: 167621644
T4SS name [ID]Trb [468]
Gene symbol-
Locus tagCaul_5374
StrainCaulobacter sp. K31
Repliconplasmid pCAUL02 [GenBank: NC_010333] [Browse all T4SS(s) in this replicon]
Location [Strand]86140..86496 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB0T9U4
KEGG IDcak:Caul_5374
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.1e-21, Aligned region: 17..109
Protein Sequence: 118 a.a.     [Download]
>gi|167621644|ref|YP_001672152.1| conjugal transfer protein TrbC [Caulobacter sp. K31]
MNLIRNVSSAPHRFGRAAHSAILTVGVGLLLATPAWAGGGGTAMPWEGPLTTVMQSLSGPVAKAIGIIAI
VLAGLGFAFAEGGSAMRKGIGIVFGLAIAFTATTFVSTFFNLTAGAAF
 
Nucleotide Sequence: 357 bp     [Download]
>gi|167621562|ref|NC_010333.1|:c86496-86140 Caulobacter sp. K31 plasmid pCAUL02, complete sequence
ATGAATCTGATCCGAAATGTCTCGTCCGCGCCGCATCGCTTTGGGCGAGCCGCCCACTCCGCAATACTCA
CCGTCGGCGTCGGCCTACTTCTGGCCACTCCAGCTTGGGCTGGTGGCGGCGGCACCGCCATGCCCTGGGA
GGGCCCGCTTACCACGGTGATGCAGTCGCTCTCCGGTCCTGTCGCCAAGGCAATTGGCATCATCGCCATC
GTCTTGGCCGGACTGGGCTTTGCCTTCGCCGAGGGCGGCTCGGCCATGCGAAAGGGCATCGGCATCGTCT
TTGGGCTGGCCATCGCCTTCACCGCCACGACCTTCGTCAGCACCTTCTTCAACCTCACCGCCGGCGCGGC
GTTCTGA
 Primer design