SecReT4
Protein ID: 167621864
T4SS name [ID]Trb [291]
Gene symbol-
Locus tagCaul_5215
StrainCaulobacter sp. K31
Repliconplasmid pCAUL01 [GenBank: NC_010335] [Browse all T4SS(s) in this replicon]
Location [Strand]139043..140110 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB0T9G0
KEGG IDcak:Caul_5215
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.2e-59, Aligned region: 123..350
Protein Sequence: 355 a.a.     [Download]
>gi|167621864|ref|YP_001676649.1| P-type conjugative transfer protein TrbG [Caulobacter sp. K31]
MSTSRITLRSTAIALLVLAAGAGALGPSVRALAQGPSQREVQGPAAAPPALSVRPAAQIAPAKAAATTTR
PASANTPSTPRPRARVTRTHRARAAASGPLATIARANAEARDWPRSAAYVNSALYYDFEPGRLYTIHTSP
RFLTTITLKPGEKLIAKAAGDTVRWVLGETQSGAGEAAQVVIFVKPIRPDLRTNIILTTDQRTYLIDAVS
NASPTYTSVLSWNYPQDLAREAAQQRQRDQALAATRTAVSVADAIPIDQLNFRYRVEPRKGRAPRWTPIR
VFDDGAKTYIEFPADLATSEAPPLFLLGANDQAELVNYRQRGLYYVVDRLIDRAELRLGDKHQAVVRIAR
AGAAR
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|167621728|ref|NC_010335.1|:c140110-139043 Caulobacter sp. K31 plasmid pCAUL01, complete sequence
ATGAGCACCAGCCGCATCACGCTGCGATCAACGGCCATCGCCCTGCTGGTCCTGGCGGCGGGCGCGGGCG
CCTTGGGCCCGTCGGTTCGCGCCCTGGCCCAAGGCCCGTCCCAGAGGGAGGTGCAAGGTCCGGCCGCGGC
TCCCCCGGCTTTGTCGGTCCGGCCTGCCGCTCAGATCGCGCCCGCCAAAGCGGCGGCGACCACGACCAGA
CCGGCGAGCGCCAACACCCCATCGACCCCAAGGCCCCGCGCCCGCGTCACGCGCACGCACCGGGCGCGAG
CTGCCGCTTCTGGGCCCCTGGCCACCATCGCGCGCGCCAACGCCGAGGCGCGCGATTGGCCCCGCTCAGC
CGCCTACGTCAATTCCGCGCTCTATTATGATTTCGAGCCGGGCCGCCTCTACACCATCCACACCAGCCCC
CGCTTCCTGACGACCATCACGCTCAAGCCCGGGGAGAAGCTGATCGCCAAGGCGGCGGGCGACACCGTGC
GCTGGGTGCTGGGCGAGACCCAGTCGGGGGCCGGGGAAGCGGCCCAGGTGGTAATCTTCGTCAAGCCCAT
CCGGCCCGACCTGCGCACCAACATCATCCTGACGACCGATCAGCGCACCTATTTGATCGATGCGGTCAGC
AACGCCTCGCCCACCTATACCAGCGTGCTCAGCTGGAACTATCCGCAAGACCTGGCTCGCGAGGCGGCCC
AGCAACGCCAGCGGGACCAGGCGCTGGCCGCCACGCGAACAGCCGTCTCGGTCGCTGACGCCATTCCCAT
CGATCAGCTGAACTTCCGCTATCGCGTGGAGCCGCGCAAAGGCCGCGCGCCGCGCTGGACGCCTATCCGC
GTCTTCGATGACGGGGCCAAGACCTATATCGAATTCCCGGCCGATCTGGCGACCAGCGAGGCGCCGCCGC
TTTTCCTGCTGGGGGCGAACGACCAGGCCGAGCTGGTCAATTACCGACAGCGGGGACTCTATTATGTCGT
CGATCGCCTGATCGATCGGGCTGAACTGCGCCTGGGCGACAAGCATCAGGCCGTGGTGCGCATCGCGCGC
GCCGGAGCGGCCCGGTGA
 Primer design