SecReT4
Protein ID: 167621866
T4SS name [ID]Trb [291]
Gene symbol-
Locus tagCaul_5217
StrainCaulobacter sp. K31
Repliconplasmid pCAUL01 [GenBank: NC_010335] [Browse all T4SS(s) in this replicon]
Location [Strand]140806..142086 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDB0T9G2
KEGG IDcak:Caul_5217
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.8e-38, Aligned region: 39..264
Protein Sequence: 426 a.a.     [Download]
>gi|167621866|ref|YP_001676651.1| P-type conjugative transfer protein TrbL [Caulobacter sp. K31]
MSTASPAALDEYLNRYTTQVGGGFGLLQGDVQAVFASLVIISLGLSGLLWALDENENVPAALIRKVLLFG
FFAWLITGWHAITQTVVNGFAALGLKAGGGSLSVGDLMHSPSKVVIDGLKVAFELLKYMGRLASEGMGVG
FFTHLDAILVTGLAAIGIIAAFVVLGIHIATVIIEFYIVTLIGFVTVPFGILTQTSFLSERAIGYVVAIG
VKVMAIAIVISIGEQIFASYIVSPEPDWSESCGLLIAALFFCMLGFKIPAIAQAQITGGPQLSAGSAAAG
AIGLAATVGGLALAGRWAAGGLAASAGAASARGAAGLRTQLGRGGSGSAGGGGSSGGPSGGGPSGGAPSG
AAVSDVVSRAKASFSPPPAPPPSPATDGAAAAAPASGQAAKRPGPGRSAAAAAPWREDADGAPIGMPAIH
PPSDEA
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|167621728|ref|NC_010335.1|:c142086-140806 Caulobacter sp. K31 plasmid pCAUL01, complete sequence
ATGTCGACCGCCTCTCCGGCCGCCCTGGATGAGTATCTCAATCGCTACACGACCCAGGTTGGTGGCGGGT
TTGGCCTGCTGCAGGGCGATGTTCAGGCGGTGTTCGCGAGCCTGGTGATCATCAGCCTGGGCCTGTCGGG
GCTGCTGTGGGCGCTAGACGAGAATGAAAACGTCCCCGCCGCCCTGATCCGCAAGGTGCTATTGTTTGGG
TTCTTCGCCTGGCTGATCACCGGCTGGCACGCCATCACCCAGACCGTGGTCAACGGCTTTGCGGCCCTGG
GCCTGAAGGCGGGCGGAGGAAGCCTGTCGGTCGGCGACCTGATGCACTCGCCGTCCAAGGTGGTGATCGA
CGGTCTGAAGGTCGCCTTCGAGCTGCTCAAATACATGGGACGCCTGGCCTCGGAGGGCATGGGCGTGGGG
TTCTTCACCCACCTGGACGCCATCCTGGTCACGGGTCTGGCCGCCATAGGGATCATCGCCGCCTTTGTGG
TGCTGGGCATCCACATCGCCACGGTGATCATCGAGTTCTACATCGTCACCTTGATCGGCTTCGTCACGGT
GCCGTTCGGCATCCTCACCCAAACTTCGTTCCTGTCGGAGCGGGCCATTGGCTATGTGGTGGCCATCGGG
GTCAAGGTGATGGCCATCGCGATCGTCATTTCGATCGGCGAGCAGATCTTCGCCAGCTACATCGTCTCGC
CCGAGCCCGACTGGAGCGAGTCCTGCGGCCTGCTGATCGCCGCGCTCTTCTTCTGCATGCTGGGGTTCAA
GATCCCCGCCATCGCCCAGGCCCAGATCACCGGCGGTCCGCAACTGAGCGCGGGTTCGGCGGCGGCCGGG
GCGATCGGCCTGGCCGCCACCGTGGGCGGGTTGGCCCTGGCCGGTCGTTGGGCGGCCGGCGGCCTGGCGG
CCAGCGCCGGCGCGGCTTCGGCCCGCGGCGCGGCGGGTCTTCGCACCCAGCTGGGCCGTGGCGGGTCCGG
ATCTGCGGGCGGCGGCGGTTCGAGCGGGGGGCCGTCGGGGGGCGGCCCCTCTGGCGGCGCGCCCAGCGGC
GCGGCGGTTTCCGATGTCGTCTCCCGCGCCAAGGCGTCGTTTTCTCCTCCGCCCGCGCCCCCGCCCTCCC
CGGCGACCGACGGGGCCGCCGCCGCGGCGCCGGCCTCCGGACAGGCCGCCAAACGGCCGGGCCCAGGCCG
CTCGGCCGCCGCCGCCGCGCCCTGGCGCGAAGACGCCGACGGCGCGCCGATCGGCATGCCCGCCATCCAT
CCGCCCAGCGACGAAGCTTGA
 Primer design