SecReT4
Protein ID: 167621872
T4SS name [ID]Trb [291]
Gene symbol-
Locus tagCaul_5223
StrainCaulobacter sp. K31
Repliconplasmid pCAUL01 [GenBank: NC_010335] [Browse all T4SS(s) in this replicon]
Location [Strand]146025..146372 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB0T9G8
KEGG IDcak:Caul_5223
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.4e-20, Aligned region: 12..104
Protein Sequence: 115 a.a.     [Download]
>gi|167621872|ref|YP_001676657.1| conjugal transfer protein TrbC [Caulobacter sp. K31]
MSSPAAHRPWTMPKTRSLILGLALATLAAEPAFAGGTGGGMPWDNLLTTIADSITGPVAKAIGVIAIALT
GLGFAISEGGSWVRKGMGVLFGLCVAFSASTFFLGWLGFTGGAGF
 
Nucleotide Sequence: 348 bp     [Download]
>gi|167621728|ref|NC_010335.1|:c146372-146025 Caulobacter sp. K31 plasmid pCAUL01, complete sequence
ATGTCATCGCCAGCCGCACACCGTCCTTGGACCATGCCCAAGACCCGATCGCTCATCCTGGGCCTGGCCT
TGGCGACGCTCGCCGCCGAGCCGGCCTTCGCCGGCGGCACGGGCGGCGGCATGCCCTGGGACAACCTGCT
GACCACTATCGCCGACTCCATCACCGGCCCGGTGGCCAAGGCGATCGGCGTCATCGCCATCGCCTTGACC
GGTCTGGGCTTTGCGATCTCCGAGGGCGGGTCCTGGGTGCGCAAGGGCATGGGGGTGCTCTTTGGCCTGT
GCGTGGCCTTCTCGGCCTCGACCTTCTTCCTGGGCTGGCTGGGTTTCACCGGCGGGGCGGGCTTTTGA
 Primer design