SecReT4
Protein ID: 16763011
T4SS name [ID]Tfc [742]
Gene symbolpilL
Locus tagSTY4539
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4423868..4425112 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDQ8Z1L3
KEGG IDstt:t4239, sty:STY4539
PDB IDNA
Domain hit(s) vs Pfam TcpQ [PF10671], Evalue: 9.6e-25, Aligned region: 324..411
Protein Sequence: 414 a.a.     [Download]
>gi|16763011|ref|NP_458628.1| hypothetical protein STY4539 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MNTQALFCLSLPLVIAGCAQQTSTQTARDSAFAQSQQPSVFSDIYQRSPEVTRSGRYTLVSIKSADAQRE
PLNQLIDITMPGQLVNSVGDGFRYLLFQSGYSLCGHYGADFSELLNRPLPAVQRKIGPMRLSEALQVVAG
PAWRMSVDEVNREVCFVLRDAYRVQAKTKALTSVTPAVTGAARTSSPETTRNPYTGVLPGNKAEPVIAGQ
HLAAKKGTELKPVSQSLPVPALRPGGTPVTSGVSSAPPVKQVSSPAPRNPFTGKNLTGTTLSASHSPAPV
GEKAQAKTPSPSTVKAVNPATATVLATTTKPLTGTPVAAVASGPEWKAVVGSTLKESLTDWAGRADCPGG
GHWVVIWQTPTDYRIDAPLVFKGNFETALVQVFDLYKKADKPLFAEASRLQCLVSVADKPADRS
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4423868-4425112 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGAACACACAAGCGCTTTTCTGCCTGAGCCTGCCGCTGGTGATTGCCGGGTGTGCACAGCAGACCTCCA
CCCAAACCGCTCGCGACAGCGCATTTGCACAGAGTCAGCAGCCTTCCGTCTTCTCTGATATTTACCAGCG
ATCACCGGAGGTGACTCGCAGCGGGCGTTACACGCTGGTCAGTATTAAAAGTGCGGATGCGCAGCGGGAA
CCGCTCAACCAGCTCATCGATATTACTATGCCAGGGCAACTGGTTAACTCAGTCGGTGACGGATTTCGCT
ACCTGCTGTTTCAGTCTGGTTATTCCCTGTGCGGACATTATGGTGCTGACTTTTCTGAGCTGCTGAACCG
GCCGTTACCGGCCGTTCAGCGCAAAATTGGGCCGATGCGACTCAGTGAGGCACTGCAGGTGGTCGCCGGT
CCTGCCTGGCGAATGTCCGTGGATGAAGTCAACCGGGAGGTCTGTTTCGTATTGCGTGATGCATATCGGG
TACAGGCTAAAACTAAAGCACTGACATCTGTCACACCCGCCGTGACCGGCGCCGCAAGAACCTCCTCCCC
GGAAACCACCCGCAATCCTTATACCGGCGTTCTGCCGGGGAATAAAGCTGAACCCGTGATCGCCGGCCAG
CACCTGGCGGCGAAGAAAGGTACTGAACTGAAACCGGTCAGTCAGTCACTTCCTGTCCCTGCCCTGAGAC
CTGGTGGGACACCGGTAACGTCAGGAGTGTCCTCTGCCCCCCCCGTGAAACAAGTCTCTTCTCCGGCTCC
GCGCAATCCGTTCACAGGAAAAAACCTGACCGGGACCACCCTGTCGGCGTCTCATTCACCGGCGCCTGTG
GGAGAGAAGGCTCAGGCTAAAACACCGTCTCCCTCAACCGTTAAGGCTGTAAATCCGGCGACGGCTACGG
TACTGGCCACGACAACAAAACCGTTAACCGGTACGCCTGTAGCTGCAGTGGCCAGTGGCCCTGAGTGGAA
GGCGGTTGTCGGCAGCACGCTCAAAGAGTCCCTGACTGACTGGGCCGGAAGAGCTGACTGTCCGGGGGGA
GGACACTGGGTGGTTATCTGGCAGACCCCTACGGATTACCGCATTGACGCACCGTTGGTATTTAAAGGCA
ACTTTGAGACGGCGCTGGTTCAGGTGTTTGACCTTTATAAGAAAGCTGACAAGCCCTTATTTGCTGAAGC
TTCCCGCCTGCAGTGCCTGGTTTCAGTTGCGGATAAACCGGCTGACCGGTCGTAG
 Primer design