SecReT4
Protein ID: 16763027
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4558
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4439581..4440321 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDQ8Z1K6
KEGG IDstt:t4256, sty:STY4558
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 246 a.a.     [Download]
>gi|16763027|ref|NP_458644.1| hypothetical protein STY4558 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MKPMKSTLNCLRQWTASVMLAVIVSLPALASVSTGRSVSAPQQQNTTTEGRTQTSGTAWGLSEKEWQQYQ
QVLKGPRAFQSPGIDPLMALGLEAGSASERRRFAEMWVKEEYARGEKELAFQREVDAAWKRLYPNTLSVN
MGNASGIAHDTQGRLALFVKRNCVPCDARVSAVLADNRPVDIYLVDSGGSDDTIRQWALAHHIPVDKVRS
RQITLNHDNGNWLKYGQGYMPVMLQQGVSGWQIAAF
 
Nucleotide Sequence: 741 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4439581-4440321 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGAAACCGATGAAATCAACGTTAAATTGCCTCCGGCAGTGGACTGCGTCAGTCATGCTGGCTGTTATCG
TAAGTCTGCCTGCTCTTGCATCAGTGAGTACGGGTCGCAGTGTAAGCGCACCCCAGCAGCAAAATACGAC
TACAGAAGGAAGGACGCAAACGTCAGGAACGGCATGGGGACTCAGCGAAAAAGAATGGCAGCAGTATCAA
CAGGTACTTAAAGGTCCCAGAGCATTTCAGTCACCTGGCATTGACCCGTTGATGGCACTGGGGCTGGAGG
CCGGTTCGGCAAGCGAACGCCGGCGTTTTGCTGAAATGTGGGTGAAGGAAGAGTATGCCCGGGGTGAAAA
GGAGCTGGCCTTTCAGCGGGAAGTGGATGCTGCCTGGAAACGCCTTTATCCCAATACTCTCTCCGTAAAC
ATGGGCAATGCCAGCGGTATTGCCCATGATACACAGGGAAGACTGGCGTTATTTGTGAAGCGCAACTGTG
TACCGTGCGATGCCAGAGTAAGTGCGGTTCTGGCAGATAACCGTCCGGTTGATATTTACCTGGTCGACAG
TGGCGGCAGTGATGACACCATTCGCCAGTGGGCGCTTGCACATCATATTCCGGTCGATAAAGTTCGTAGC
CGGCAGATAACCCTCAACCACGATAACGGCAACTGGCTGAAGTATGGTCAGGGATATATGCCGGTTATGC
TTCAGCAGGGAGTCTCCGGATGGCAAATCGCAGCATTCTGA
 Primer design