SecReT4
Protein ID: 16763028
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4559
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4440435..4440986 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDQ8Z1K5
KEGG IDstt:t4257, sty:STY4559
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 183 a.a.     [Download]
>gi|16763028|ref|NP_458645.1| hypothetical protein STY4559 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MATEVGVPAEALYSVSLAETSRKLPHGERPWPWTLNVAGKGYRYNSRQEAYDAMLSFMRRYPLKRIDVGI
AQVNLGWNGTYFSSYYEALDPYTNLRVAARILKSCYDNNPGSWIQAAGCYHHPAGGKPARIYKSIVKRKL
ATLDLNAPVTYSELQIAQISPSQRHFSHYNRELQWVEPRESRQ
 
Nucleotide Sequence: 552 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4440435-4440986 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
GTGGCAACTGAAGTCGGCGTACCCGCTGAAGCCCTGTATTCAGTTTCTCTTGCAGAAACATCCCGAAAAC
TACCACATGGAGAGCGACCGTGGCCGTGGACACTCAATGTTGCCGGGAAAGGGTATCGGTATAACTCCCG
CCAGGAAGCGTATGACGCAATGTTGTCGTTCATGCGTCGCTATCCGTTAAAGCGGATTGATGTTGGGATC
GCGCAGGTTAACCTGGGCTGGAATGGAACTTATTTCAGCAGTTACTACGAAGCGCTGGATCCATATACCA
ACCTTCGGGTTGCCGCCCGTATTCTTAAATCCTGTTATGACAACAATCCGGGAAGCTGGATACAGGCCGC
GGGGTGTTATCACCATCCTGCAGGTGGAAAACCAGCACGAATCTATAAGTCCATCGTGAAACGCAAGCTG
GCAACACTGGATTTAAACGCGCCAGTAACGTACTCCGAACTTCAGATCGCACAGATATCGCCATCACAGC
GCCATTTCTCACACTACAACCGTGAATTGCAATGGGTTGAACCCAGGGAGTCCCGTCAGTGA
 Primer design