SecReT4
Protein ID: 16763029
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4560
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4441022..4441522 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDQ8Z1K4
KEGG IDstt:t4258, sty:STY4560
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.2e-49, Aligned region: 17..164
Protein Sequence: 166 a.a.     [Download]
>gi|16763029|ref|NP_458646.1| hypothetical protein STY4560 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MVSILLTTSSMAALNVIADLGGEPTAPLFDAINNKNNEFTPPRSLNATGASVTAAPADVSDMLPVTTPEM
RAGKVEARELNLNGMTPVFLVGDDSLSREWLTMRRDELKRLHATGLVVNVSDKDALSELQQIIPDVILLP
ASASEIARRLHLNHYPVLITATGLAQ
 
Nucleotide Sequence: 501 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4441022-4441522 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGGTCAGTATTTTGCTGACAACATCATCGATGGCAGCACTCAATGTGATTGCTGATCTTGGCGGAGAAC
CAACAGCGCCGCTTTTTGATGCCATCAATAATAAGAACAACGAGTTCACTCCGCCGAGGTCACTGAACGC
CACGGGCGCGTCTGTAACCGCAGCCCCTGCGGATGTAAGTGATATGCTGCCCGTAACCACACCGGAAATG
CGTGCAGGGAAAGTGGAAGCCCGTGAGTTAAATCTGAACGGGATGACACCGGTCTTTCTTGTTGGGGATG
ATTCGCTTTCACGCGAGTGGTTGACGATGCGGCGTGATGAGCTTAAGCGACTTCATGCTACAGGTCTGGT
GGTGAATGTCAGCGATAAGGACGCGTTGTCGGAACTTCAGCAAATCATACCTGATGTCATTCTGCTACCG
GCATCGGCAAGCGAAATAGCGCGTCGTTTGCATCTCAACCACTACCCGGTGTTGATTACCGCCACCGGTC
TGGCCCAGTAG
 Primer design