SecReT4
Protein ID: 16763032
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4563
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4444208..4444966 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ8Z1K1
KEGG IDstt:t4261, sty:STY4563
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 5.8e-70, Aligned region: 50..249
Protein Sequence: 252 a.a.     [Download]
>gi|16763032|ref|NP_458649.1| hypothetical protein STY4563 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MSTEKNSSQSSPPPRKPPGLLTLVLWIWPVRLLAFLLVSWMAGVFIEWAGMFFFWSDQGALHSQSVMNKE
LGYLSADFTQSLIFSSPSVTTMGWISSAYQWAFVDSGLLTWIQKEQRETLSSSDSVVFFLGQVQAWLLSV
LSDYLLALVYVTVVFAVRVLILVLSIPLFVLVIIVAVIDGLCRRDLRRYGAGYESSFLYHHAKRFVKPAV
YLPCLLYLSWPASIYPNLLLLPGALLLGLAVTVVTSTFKKYL
 
Nucleotide Sequence: 759 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4444208-4444966 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGAGTACAGAAAAAAACAGCTCTCAAAGTTCTCCACCACCGCGCAAGCCACCAGGTTTGCTGACCCTTG
TTTTGTGGATCTGGCCAGTCAGGCTTTTGGCTTTTCTGCTGGTATCCTGGATGGCTGGTGTTTTTATTGA
ATGGGCAGGAATGTTTTTTTTCTGGTCAGATCAGGGAGCTTTGCATTCCCAGTCCGTTATGAATAAAGAA
CTTGGCTATTTATCAGCAGATTTTACTCAAAGCCTTATTTTTTCTTCACCATCAGTAACTACGATGGGCT
GGATTTCGTCAGCTTACCAATGGGCATTTGTGGACAGTGGATTACTCACCTGGATTCAGAAAGAACAAAG
GGAGACATTAAGCAGTTCTGACTCTGTTGTTTTTTTTCTGGGACAAGTGCAGGCCTGGTTATTATCAGTG
TTAAGCGATTATCTGCTTGCGCTGGTTTATGTCACCGTCGTTTTTGCCGTCAGGGTATTAATTCTTGTTT
TATCCATCCCGTTATTTGTTCTGGTTATCATCGTCGCTGTTATAGACGGGTTGTGTCGTCGTGACCTGAG
ACGTTACGGGGCGGGTTATGAGTCGAGTTTTCTGTATCACCATGCCAAACGGTTTGTTAAACCGGCTGTT
TATCTCCCTTGCTTACTTTACTTGTCATGGCCTGCGTCGATTTATCCAAATCTGTTACTTCTGCCCGGGG
CATTGTTACTGGGACTGGCGGTTACTGTAGTGACATCTACATTCAAAAAATATCTGTGA
 Primer design