SecReT4
Protein ID: 16763033
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4564
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4445185..4445457 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ8Z1K0
KEGG IDstt:t4262, sty:STY4564
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.5e-30, Aligned region: 9..85
Protein Sequence: 90 a.a.     [Download]
>gi|16763033|ref|NP_458650.1| hypothetical protein STY4564 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MFSLPEMVSAAEKDELALALRQLDQVQSALERAKIVAVQDNSDGRFFFDYERATRDLKTMKQGIETYLEP
SRAQPRDKGSLVGQYRKEQP
 
Nucleotide Sequence: 273 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4445185-4445457 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
TTGTTCTCTCTGCCAGAGATGGTCAGTGCAGCTGAAAAGGATGAACTGGCCCTCGCTCTCAGGCAGCTGG
ACCAGGTCCAGTCTGCGCTTGAACGCGCGAAAATTGTAGCGGTACAGGACAATTCTGACGGGCGTTTCTT
CTTCGACTATGAGCGGGCAACACGTGATTTGAAAACCATGAAGCAGGGGATTGAAACTTATCTGGAGCCT
TCCCGGGCACAGCCAAGAGACAAAGGTTCTCTTGTTGGACAATACAGGAAGGAGCAGCCCTGA
 Primer design