SecReT4
Protein ID: 16763036
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4568
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4446469..4447122 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDQ8Z1J7
KEGG IDstt:t4265, sty:STY4568
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.4e-94, Aligned region: 5..203
Protein Sequence: 217 a.a.     [Download]
>gi|16763036|ref|NP_458653.1| hypothetical protein STY4568 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MSRFRHALKDRDQHILTLRLACGVLLLLLILVITGWMRAPSDLTIHNPPDLRSGSTRKWWEVPPSTVYSF
AFYIFQQINAWPKDGEKDYPMKIAQLSPYLTPSCQDFLNKDAELRSQKGELLDRVRVVYEIPKRGYKPES
VIIESDDSWEVSLDLVVDEYYHTEPVKRALARYPLHIVRWEGDPERNAFGLALDCYKGVPQRLEAAVVPE
PEKKGMF
 
Nucleotide Sequence: 654 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4446469-4447122 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGAGCCGATTTCGCCATGCTCTGAAGGATCGCGATCAGCATATTTTGACCCTGAGATTAGCGTGTGGAG
TTCTGCTTCTCTTATTGATTCTGGTTATTACAGGATGGATGCGGGCGCCCAGTGACCTGACAATACATAA
CCCGCCAGATTTACGCAGCGGGAGTACGCGTAAATGGTGGGAGGTCCCTCCGAGTACGGTCTACAGCTTT
GCCTTTTATATTTTTCAGCAAATTAATGCCTGGCCGAAGGACGGAGAAAAAGACTATCCGATGAAAATTG
CCCAGTTGAGTCCTTATCTTACGCCATCATGCCAGGATTTTTTGAATAAGGATGCTGAGCTACGGAGTCA
AAAAGGTGAGTTGCTTGATCGCGTTCGCGTCGTTTATGAGATCCCCAAACGTGGTTACAAACCTGAAAGT
GTCATCATTGAGAGCGATGACAGTTGGGAGGTCAGTCTGGATTTGGTAGTCGATGAATACTATCACACAG
AACCTGTAAAACGGGCACTGGCCAGATACCCCCTGCATATTGTCCGCTGGGAAGGTGATCCGGAGCGCAA
TGCTTTTGGTCTGGCGCTTGATTGCTATAAAGGCGTCCCACAACGACTTGAAGCTGCAGTGGTCCCTGAG
CCAGAGAAAAAGGGGATGTTTTAA
 Primer design