SecReT4
Protein ID: 16763037
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4569
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4447122..4448021 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDQ8Z1J6
KEGG IDstt:t4266, sty:STY4569
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.7e-116, Aligned region: 10..294
Protein Sequence: 299 a.a.     [Download]
>gi|16763037|ref|NP_458654.1| hypothetical protein STY4569 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MAMFKVLNFKCKWWPIILLLWFSSAQAVELMKWERIPLLIPLSVNHERIVFVDRNVRVGFPAMLKGKLRV
QSSGGTVYLQASEPFEQTRLQLQDVESGEIILLDIAAKNDNKALEPVRLVYSGEVLSVSEKGMETGSSLP
VASLDTEDKNQTVRKTPVYSAPLPVVLTRYAAQSLYAPLRTVEAVPGIHPVNLRLPSRLTTLYPSENVVV
SPIGAWGIQELNVVALKIRNRSSSKVILDARTLSGSFVSATFQHRWLGAAGTPEDTTTLYLVIRGRPENA
FIAEPAVLPAVKKGEQHAN
 
Nucleotide Sequence: 900 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4447122-4448021 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGGCGATGTTTAAAGTCCTTAATTTTAAGTGTAAATGGTGGCCGATAATTCTCCTTTTATGGTTTTCAT
CAGCACAGGCTGTGGAGCTGATGAAATGGGAACGGATCCCTCTGCTTATTCCACTTTCTGTTAACCATGA
GCGAATTGTCTTTGTCGACCGCAACGTTCGTGTAGGTTTTCCGGCAATGCTCAAAGGTAAACTGAGGGTT
CAAAGCAGCGGTGGTACGGTTTATTTACAGGCCAGCGAACCTTTTGAACAGACCCGACTTCAACTGCAGG
ATGTTGAATCGGGCGAGATTATATTACTGGATATTGCTGCCAAAAATGACAATAAGGCGCTTGAGCCTGT
TCGCCTGGTTTATTCGGGAGAAGTGTTATCGGTGAGCGAAAAAGGAATGGAAACGGGTTCTTCGTTGCCA
GTCGCCTCTTTGGATACAGAAGATAAAAATCAGACTGTCAGAAAAACGCCGGTGTACAGTGCTCCATTGC
CAGTGGTGTTGACTCGTTATGCTGCACAAAGTCTGTATGCCCCTCTACGCACTGTTGAAGCTGTACCCGG
AATTCATCCGGTAAATTTACGCCTTCCCTCGAGACTCACAACTTTATATCCGTCTGAGAATGTAGTTGTT
TCGCCAATAGGGGCATGGGGTATTCAGGAACTGAATGTTGTTGCACTGAAAATCCGGAATCGTTCTTCCT
CCAAAGTGATACTTGATGCCCGGACTTTATCAGGATCGTTTGTCAGTGCGACTTTCCAGCATCGTTGGCT
TGGGGCGGCTGGTACGCCTGAAGATACAACAACTCTTTATCTTGTGATCAGAGGGCGCCCTGAGAATGCC
TTTATTGCTGAACCTGCAGTATTGCCGGCAGTAAAAAAAGGGGAACAGCATGCAAATTAA
 Primer design