SecReT4
Protein ID: 16763039
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4571
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4449482..4449925 [+]
Productlipoprotein
Component typeTfc15
UniProt IDQ8Z1J4
KEGG IDstt:t4267, sty:STY4571
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 147 a.a.     [Download]
>gi|16763039|ref|NP_458656.1| lipoprotein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MTDNQKITSRTVKITPVLFFIAGMFSVALGGCSSSKDELLPPGDSSMMELWQGNAPTSHAVVKGRETLRR
SLSSQETLASGRIDESYSRTQENELSQIFPRLPNPDMVMYIFPHLANGNTPVPGYSTVFPFYAQTQYALP
GERTEAL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4449482-4449925 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
TTGACTGATAATCAGAAAATCACTTCACGTACAGTGAAAATAACTCCCGTTTTATTTTTTATAGCGGGCA
TGTTCAGTGTCGCGCTTGGTGGATGCTCATCCAGCAAAGATGAATTATTGCCTCCGGGAGACAGTTCAAT
GATGGAGCTCTGGCAGGGGAATGCTCCGACATCTCACGCCGTTGTCAAAGGGCGGGAGACTCTCAGGCGG
AGTCTTTCGTCTCAGGAAACACTGGCTTCAGGGCGTATTGATGAAAGCTACAGCCGTACTCAGGAGAATG
AGCTGAGCCAGATTTTCCCCCGGTTACCTAATCCGGATATGGTGATGTACATATTTCCGCACTTGGCTAA
TGGAAATACGCCTGTTCCTGGCTACAGCACTGTCTTTCCTTTTTATGCTCAAACCCAGTATGCGCTTCCT
GGTGAACGGACGGAGGCACTGTGA
 Primer design