SecReT4
Protein ID: 16763043
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4575
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4453457..4453849 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDQ8Z1J0
KEGG IDstt:t4272, sty:STY4575
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 8.1e-39, Aligned region: 18..124
Protein Sequence: 130 a.a.     [Download]
>gi|16763043|ref|NP_458660.1| hypothetical protein STY4575 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MKRILSSLILISSFSASAQIVVYTDQGHPPVGVTPAIRVVYLDASERWLQQQFGELSSDPEQAVRQAHSL
LNSPDWKRRQKALIEHYRGMIEAWQLGLLKYPAVVFDNRDVVYGTVDISRAVALRRGENQ
 
Nucleotide Sequence: 393 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4453457-4453849 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGAAACGAATCCTCTCTTCGCTGATATTAATCAGCTCCTTTTCTGCAAGTGCGCAAATCGTTGTTTACA
CCGACCAGGGGCATCCTCCGGTCGGTGTAACACCGGCTATCCGGGTTGTTTATCTCGATGCCAGCGAACG
CTGGCTGCAGCAACAATTTGGAGAGCTTTCTTCTGATCCTGAACAGGCTGTCAGACAGGCTCATTCTCTG
CTGAATTCTCCTGACTGGAAGAGACGGCAAAAAGCGCTTATCGAACATTACAGGGGAATGATTGAAGCAT
GGCAGCTTGGTTTACTGAAATATCCGGCGGTGGTTTTTGACAACCGTGACGTGGTTTACGGGACTGTTGA
TATATCCCGGGCAGTGGCGCTGCGCAGGGGAGAGAATCAATGA
 Primer design