SecReT4
Protein ID: 16763044
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4576
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4453846..4454814 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDQ8Z1I9
KEGG IDstt:t4273, sty:STY4576
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 7e-94, Aligned region: 30..310
Protein Sequence: 322 a.a.     [Download]
>gi|16763044|ref|NP_458661.1| hypothetical protein STY4576 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MKSLRLKRALLSVMLITGGMEVQAALNTASIVASSISPSCISWRISGICYWLMCTPFGCTVKTSIKVHHF
IPEAVVSTYQASGGNPWTEMSLVSQTAGGVENAVTGALSGLAAGGGNQEQKFPGTRKSNVRFKYADAIGH
PSTSIIGGQIPGYSCNSAATPLVPYFLSTLDTLAWRTGVPESVYPEALIPGRREIGSTSAQNIWGNLYPR
SGFVTQQDDYKSGAIVAQRVADIITRTNQIHVYKPLTGNPSAGYWPPEPVKENTGTQNHKWQQLSPTLSM
SCSVFPDTGKIAENGNYAWTLWQPYSCCKRRGQTFLYSTDIN
 
Nucleotide Sequence: 969 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4453846-4454814 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGAAATCTCTTCGTCTGAAGCGAGCGTTACTGTCAGTCATGCTTATCACCGGCGGCATGGAGGTTCAGG
CTGCGTTGAACACTGCCTCGATTGTGGCCAGCAGTATTTCTCCGTCGTGTATCAGCTGGAGAATCAGCGG
TATCTGCTACTGGCTGATGTGTACCCCTTTCGGTTGTACAGTAAAAACCTCGATAAAAGTGCATCACTTT
ATTCCGGAAGCTGTTGTTTCGACTTATCAGGCGTCTGGTGGAAATCCGTGGACCGAAATGTCATTAGTGA
GTCAGACGGCCGGAGGGGTAGAGAATGCTGTAACGGGGGCGTTATCCGGGCTTGCTGCCGGTGGCGGAAA
CCAGGAACAGAAATTCCCGGGTACCCGTAAGAGTAATGTGCGATTTAAATATGCAGATGCCATTGGCCAT
CCTTCAACATCGATTATTGGCGGCCAAATCCCCGGTTACTCATGCAACAGCGCCGCCACACCACTGGTAC
CCTATTTTCTTAGCACGCTTGATACGCTTGCCTGGCGTACTGGTGTTCCTGAATCGGTTTATCCTGAGGC
ACTCATTCCTGGCAGACGCGAAATCGGCTCCACATCGGCACAAAATATATGGGGAAATCTCTATCCCCGA
AGCGGCTTTGTTACTCAGCAGGATGACTACAAATCCGGGGCAATCGTTGCGCAGCGTGTAGCTGACATTA
TCACCCGAACTAACCAGATCCACGTCTATAAGCCCCTCACCGGAAACCCGTCTGCCGGTTACTGGCCTCC
CGAACCTGTTAAAGAGAATACCGGCACGCAAAATCATAAATGGCAGCAGTTATCACCAACGCTCTCTATG
TCATGCAGCGTATTCCCGGATACAGGAAAAATTGCGGAAAACGGTAATTACGCCTGGACACTCTGGCAGC
CATATAGCTGCTGTAAACGCCGTGGGCAAACATTTCTCTATAGCACCGACATAAATTAA
 Primer design