SecReT4
Protein ID: 16763045
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4577
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4454829..4456259 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ8Z1I8
KEGG IDstt:t4274, sty:STY4577
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|16763045|ref|NP_458662.1| hypothetical protein STY4577 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MRSQSILSVCLMLGIVSSGPLSAALLDAPTLSGDGYGKSVNGAVSDKLFYSIGGGSVISTPGTMYGMKRI
GLDAGLSSDLMCGNFDIKTTVGNQLNGVTNGFKDLMGDVITGATGAVSSMPAMILQRANPGLYEMITNGV
LQAGLAFDKSKLNCESMANKLADYTLGDKSSWTESAVREEYKEAVSASGGDALRAEEARTKASGKEGATW
VGGKKAGGKGQPAIQPTRDLAKAGYNMMNNLSVTSNSTVSAGSCKGSACQKFKNSEEAAAAVVKVLGDRS
IRTCKDATECGSGGIDNAQGTTIAGTGFAPMLEDTTKENLEQLVKLVNGTEAPTQANLDKIKSGSLKVTR
GVIDALKRDPDAGALVQRLAGELAMSDTIETGLAMRRMLTTGQSEPNAADQPQAMAEADRRIEALDRELN
SLKLEMELRREVAKNTALVVVAREENRSVTNPQKESQTNADTRLSELETRKPGDSQ
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4454829-4456259 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGAGATCTCAATCCATTTTATCCGTCTGTCTCATGCTGGGTATCGTCAGTTCGGGACCGTTAAGTGCTG
CATTACTGGATGCCCCCACGTTGAGTGGTGATGGATATGGAAAGTCAGTAAATGGCGCGGTTAGTGACAA
GCTGTTTTACAGCATTGGTGGTGGTTCGGTGATTTCCACTCCCGGGACGATGTACGGAATGAAACGTATC
GGGCTGGATGCCGGACTGAGCAGTGATTTGATGTGTGGCAACTTTGATATAAAGACTACTGTCGGAAACC
AGCTTAATGGCGTCACGAATGGTTTCAAAGATTTGATGGGGGATGTGATCACCGGTGCGACCGGGGCGGT
CTCAAGTATGCCGGCGATGATCCTTCAGCGAGCAAATCCGGGTTTGTATGAAATGATCACCAATGGTGTA
CTTCAGGCAGGTCTGGCTTTTGACAAATCGAAACTGAATTGTGAAAGCATGGCCAACAAGCTGGCTGATT
ACACTTTGGGTGACAAGAGCAGCTGGACAGAATCAGCTGTGAGGGAAGAGTACAAGGAGGCGGTCAGTGC
CAGTGGCGGGGATGCGCTGCGGGCAGAAGAGGCCAGAACCAAAGCTTCAGGTAAGGAGGGCGCTACCTGG
GTAGGCGGGAAGAAAGCCGGAGGGAAAGGCCAGCCTGCCATTCAGCCAACGCGTGATCTGGCTAAAGCAG
GATACAACATGATGAATAACCTGAGCGTTACCAGCAACAGCACGGTATCCGCCGGTAGTTGCAAGGGGTC
AGCATGCCAGAAATTTAAAAACTCTGAAGAAGCTGCAGCAGCGGTCGTAAAAGTTCTGGGCGATCGGAGT
ATTCGCACCTGTAAAGATGCCACAGAATGCGGAAGCGGCGGGATTGATAATGCCCAGGGCACGACAATTG
CCGGTACCGGTTTTGCTCCCATGCTTGAGGATACAACCAAAGAGAATCTGGAACAGCTGGTAAAGCTTGT
AAATGGTACTGAGGCTCCGACTCAGGCCAATCTGGATAAAATTAAAAGTGGCAGCCTTAAGGTAACGCGT
GGTGTCATCGATGCCCTGAAACGCGATCCTGATGCCGGTGCGTTGGTTCAGAGACTGGCTGGCGAACTGG
CCATGTCCGACACGATTGAAACCGGTCTGGCGATGCGTCGCATGTTAACGACTGGCCAGTCTGAACCCAA
TGCAGCTGATCAGCCTCAGGCAATGGCTGAAGCCGATCGCCGTATTGAAGCTCTCGATCGTGAGCTTAAC
TCTCTTAAGCTGGAGATGGAACTGCGTCGGGAAGTGGCAAAAAATACCGCGCTGGTTGTGGTTGCGCGCG
AAGAAAATCGTTCGGTCACCAATCCTCAAAAAGAATCGCAGACTAATGCTGATACCCGGCTGAGTGAGCT
TGAAACGCGTAAACCAGGGGACAGCCAATGA
 Primer design