SecReT4
Protein ID: 16763047
T4SS name [ID]Tfc [742]
Gene symbol-
Locus tagSTY4579
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T4SS(s) in this replicon]
Location [Strand]4456592..4458097 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDQ8Z1I6
KEGG IDstt:t4276, sty:STY4579
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 9.6e-123, Aligned region: 8..484
Protein Sequence: 501 a.a.     [Download]
>gi|16763047|ref|NP_458664.1| hypothetical protein STY4579 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MTTSSYLEYILTILGWVVNNGLWDVLTGTGLFALPLGFKIIGIWIKTREEGDDEGNKGILSARRMEHAIY
GAFIVIIACCVPTQTVSLTTLTFDTTRAKQCGFWTPVKPGDSGYGSVVSTMSGMTASAPVWWAFMHMISK
GVTQAAVASLPCRPDLRQVRFDVQHTQITNPALAQELQDFTSDCYAQAFALWKRQDAGRTTDIDVLRDIE
WLGSKIFLKDFYPQLHSKLPRSAFPWSQSRDDGYANTGQGGYPTCSEWWSQNKTGLKSRVLDTVNTTTMT
RMAAAFKGMVSKEEYTEALIRRLVSPTSLSVSQNGRTYAGYGGNADFTLDNAVNRMASVLGTSVGALGAF
PAFDAMRQALPMVQALLLMAMYVLIPLVLVFGTYEYKTVVTLTFVTFGMHFLTFWWELARWLDSWLLEIM
YGSDSHSRWNVAGFQNSADDLIMNFVMGTMFLVLPAVWMGALSWAGVRIGGIVDTNLNKGVQPAGQHGGK
VGDKIGSGIAK
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|16758993|ref|NC_003198.1|:4456592-4458097 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGACGACATCGAGCTATCTTGAGTACATCCTGACGATTCTGGGCTGGGTTGTTAATAACGGTTTGTGGG
ATGTTCTGACAGGCACGGGACTTTTTGCATTACCACTGGGCTTTAAAATCATTGGTATCTGGATCAAAAC
ACGGGAAGAAGGGGATGATGAGGGTAATAAAGGTATCCTGTCGGCCCGACGGATGGAACATGCTATTTAC
GGGGCATTTATCGTTATTATCGCCTGCTGTGTCCCCACTCAGACAGTGTCACTGACAACGCTGACGTTTG
ATACAACCCGTGCGAAACAGTGTGGTTTCTGGACACCGGTCAAGCCCGGGGATTCAGGCTACGGTAGTGT
GGTTTCAACAATGAGTGGTATGACTGCATCTGCGCCGGTGTGGTGGGCATTTATGCATATGATTTCCAAA
GGCGTCACTCAGGCGGCTGTGGCAAGTTTACCCTGCCGGCCAGACCTGCGGCAGGTGCGTTTTGACGTTC
AGCATACGCAGATCACCAATCCTGCTCTGGCTCAGGAATTGCAGGATTTTACCAGTGACTGTTATGCACA
GGCTTTTGCGTTATGGAAACGGCAGGATGCGGGGAGAACTACGGATATTGATGTACTCAGGGATATTGAA
TGGCTGGGGTCGAAAATATTTTTGAAGGATTTTTACCCGCAGCTGCATTCGAAGTTGCCCAGGTCAGCGT
TCCCCTGGTCGCAAAGCCGCGATGACGGGTACGCAAATACCGGGCAGGGGGGGTATCCAACGTGTAGCGA
GTGGTGGTCTCAGAACAAGACAGGCCTGAAATCCCGTGTGCTGGATACGGTAAATACCACCACGATGACA
CGCATGGCGGCAGCATTTAAGGGAATGGTCAGCAAAGAGGAATACACGGAAGCGCTAATTCGACGTCTGG
TCAGTCCGACAAGTCTCTCTGTGTCACAGAATGGACGTACTTATGCAGGTTATGGCGGTAATGCCGATTT
TACGTTAGATAATGCTGTAAATCGCATGGCTTCAGTGCTGGGGACCAGTGTGGGTGCCCTTGGGGCGTTC
CCCGCATTTGATGCCATGCGCCAGGCGTTACCGATGGTTCAGGCACTTTTATTGATGGCCATGTATGTAC
TAATCCCCCTGGTGCTGGTATTCGGGACGTATGAATATAAGACAGTAGTCACTCTCACTTTTGTGACGTT
TGGGATGCATTTTCTTACGTTCTGGTGGGAGCTGGCGCGCTGGCTGGATAGCTGGCTTCTGGAGATCATG
TATGGTTCGGACAGCCATAGCCGATGGAATGTGGCCGGTTTTCAGAATAGCGCAGATGACCTGATCATGA
ACTTTGTTATGGGGACGATGTTCCTGGTGTTGCCGGCAGTGTGGATGGGGGCGCTTTCCTGGGCTGGGGT
TAGAATTGGCGGCATTGTTGACACTAACTTAAATAAGGGAGTGCAGCCAGCTGGACAGCATGGTGGCAAA
GTTGGTGATAAAATTGGCTCGGGAATAGCTAAATAA
 Primer design