SecReT4
Protein ID: 167643946
T4SS name [ID]VirB [221]
Gene symboltraN
Locus tagpTer331_18
StrainCollimonas fungivorans Ter331
Repliconplasmid pTer331 [GenBank: NC_010332] [Browse all T4SS(s) in this replicon]
Location [Strand]17230..19932 [-]
Producthypothetical protein
Component typeVirD4
UniProt IDB0ZB73
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1e-97, Aligned region: 100..262
T4SS-DNA_transf [PF02534], Evalue: 1e-97, Aligned region: 388..645
TraG-D_C [PF12696], Evalue: 7.7e-23, Aligned region: 483..607
TrwB_AAD_bind [PF10412], Evalue: 2.5e-14, Aligned region: 394..617
Ribosomal_L12 [PF00542], Evalue: 3.1e-08, Aligned region: 300..364
Protein Sequence: 900 a.a.     [Download]
>gi|167643946|ref|YP_001672044.1| hypothetical protein pTer331_18 [Collimonas fungivorans Ter331]
MEMPKWLKWVLGVVVFIAATVGAVWLAGFFFFAFSKTNPFGKTDFSTWWTYWQFYQADPVIAKRLKVSGI
VAAVVAYGAPIVALIAAMREVRSLHGEARFANASEIEKAGLFGNTGIIIGKLKNRFLMFAGMQFVLLAAP
TRSGKGVGVVIPNLLNWSESVVVLDVKLENFLITSKFRAKWGQEVYLFNPFSISEDAEGNPLNGRTHRYN
PLGYIGDDARLRVTDILAIGYSLYPGEGRDAFFDDAARNLFLGLTLYLCETPSLPRTMGELLRQSSGKGK
PVKQHIQGIVTERNFREFGDVMLNDVGEDQAEVVKAIMAAAGISEAEAEKLCDDAPIVVVKDVAAAEIEQ
VEALFKEAGAEVEVTRKLVPITQWDGVGLPPLTMECVDALNRFTATSDNTLSSIMASFNVPLTIWASPIV
DAATSANDFDLRDVRKKRMSIYLGIPANKLAEAKLLMNMFYTQLVNLNTNRLLHSSPELKYTVLMLDDEF
TAPGRIGIIDKANSYMAGYGLRMLNIIQSPGQLEAEAPKGYGRENARTFVTNHACQIFFTPREQRDANEY
SEALGYYTFKAKGSSRQLGGKAAGGRSESESDQKRALMMPQELKEMSQREQIISLENTKAIRCEKISYFS
DHVFVDRLKSVTPSLAKLGKKLPTKKQLEDAWGSGECAVSIPLLNLDLHEAVVQARSRALTVTDVAKGID
LRALALDFSKVPLPTGDGIEAEQVEAFVDGFFDALDAANEYDEDEAPDVDEDGASERPSDDELAALDAEA
ADDGGKVAVNTIEQADDEPAAAELVTGASRPGGGSVAKPEPQAEPEPEPDRGLGHDQADIEPDGPTDEDL
AAMMEDFTPPDDGMMDEADMLAALDEMEAVPEYVEEAENDAPILDLSVLDKPLPSIKNAK
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|167643928|ref|NC_010332.1|:c19932-17230 Collimonas fungivorans plasmid pTer331, complete sequence
ATGGAAATGCCAAAGTGGCTTAAATGGGTGTTGGGCGTGGTGGTGTTCATCGCCGCCACAGTCGGCGCTG
TCTGGCTGGCCGGCTTCTTCTTCTTCGCTTTCAGCAAGACGAACCCGTTCGGCAAAACCGACTTCTCGAC
GTGGTGGACGTACTGGCAGTTTTACCAAGCTGACCCGGTGATTGCGAAGCGCCTCAAGGTGTCCGGCATC
GTGGCCGCCGTGGTGGCCTACGGTGCGCCCATCGTGGCGTTGATCGCCGCCATGCGCGAAGTGCGGTCAC
TGCACGGTGAAGCTCGTTTCGCCAATGCCAGCGAGATTGAAAAGGCCGGGCTGTTCGGCAATACCGGCAT
CATCATCGGCAAGCTGAAAAACCGCTTCTTGATGTTCGCCGGTATGCAGTTCGTCTTGCTGGCCGCGCCG
ACTCGCTCGGGCAAAGGCGTCGGGGTTGTGATTCCGAACCTGCTGAACTGGTCGGAATCGGTTGTGGTGC
TGGACGTGAAGCTCGAAAACTTCCTCATCACGTCGAAGTTCCGCGCGAAGTGGGGCCAAGAGGTCTATTT
GTTCAATCCGTTCTCGATTTCCGAGGACGCCGAAGGGAACCCACTCAACGGTCGGACGCATCGCTACAAC
CCATTGGGCTACATCGGGGACGATGCACGCTTGCGGGTGACTGACATTCTGGCAATTGGCTACTCGCTCT
ATCCGGGCGAAGGCCGCGATGCCTTTTTCGATGACGCCGCGCGCAACCTGTTCTTGGGCTTGACCCTGTA
CCTGTGTGAAACGCCAAGCCTGCCGCGCACGATGGGCGAATTGCTTCGCCAGTCGTCCGGCAAAGGCAAA
CCGGTCAAGCAACACATTCAAGGCATCGTCACGGAACGCAACTTCCGCGAGTTCGGCGACGTGATGCTGA
ACGATGTCGGGGAAGATCAGGCCGAAGTCGTGAAGGCCATCATGGCGGCTGCTGGCATCAGCGAAGCCGA
AGCCGAAAAGCTGTGCGACGACGCGCCGATAGTTGTCGTAAAGGACGTGGCAGCGGCCGAGATTGAGCAA
GTCGAAGCGCTGTTCAAGGAAGCCGGGGCCGAAGTGGAAGTGACCCGCAAACTGGTGCCGATCACGCAAT
GGGACGGCGTGGGTCTGCCGCCGCTAACGATGGAATGTGTGGATGCTCTGAACCGCTTCACGGCCACGTC
GGATAACACGCTTTCAAGCATCATGGCCTCGTTCAACGTGCCGCTGACCATTTGGGCCAGCCCTATCGTT
GACGCCGCGACCAGCGCGAACGATTTCGACTTGCGAGACGTGCGCAAGAAGCGCATGTCGATCTACCTGG
GCATTCCGGCAAACAAGCTGGCCGAAGCCAAGTTGTTGATGAATATGTTCTACACGCAGTTGGTGAACCT
CAACACGAACCGACTGCTGCATTCGTCGCCTGAACTCAAGTACACCGTGCTGATGCTGGATGACGAATTC
ACCGCACCCGGCCGCATCGGCATCATCGACAAGGCGAACTCGTACATGGCCGGCTATGGCCTGCGCATGT
TGAACATCATCCAGTCGCCCGGCCAGTTGGAAGCGGAAGCACCCAAGGGCTACGGCCGCGAGAACGCGCG
AACCTTTGTCACGAACCATGCTTGCCAGATTTTCTTCACGCCTCGGGAGCAGCGGGACGCGAACGAATAT
TCGGAAGCTCTCGGCTATTACACATTCAAGGCTAAGGGCAGCAGTCGCCAGCTCGGCGGTAAGGCGGCAG
GTGGTCGTAGTGAGTCCGAATCGGATCAAAAACGGGCGCTCATGATGCCGCAGGAACTCAAGGAAATGAG
CCAGCGCGAGCAAATCATCAGCCTTGAAAATACCAAGGCGATTCGGTGCGAAAAGATCAGCTACTTTTCG
GATCACGTCTTTGTGGATCGCCTGAAATCCGTCACGCCATCACTGGCGAAACTCGGCAAGAAGCTGCCGA
CGAAGAAGCAGCTTGAAGATGCTTGGGGTTCGGGTGAATGCGCCGTGTCGATTCCTCTGCTGAACCTTGA
TCTACACGAAGCCGTCGTGCAGGCCCGTAGCCGCGCCCTCACGGTGACCGACGTAGCGAAGGGCATCGAC
CTGCGCGCACTCGCGCTGGACTTCTCCAAGGTGCCATTGCCGACCGGCGACGGCATCGAGGCCGAACAGG
TCGAGGCGTTCGTAGATGGCTTTTTCGACGCACTCGATGCGGCGAATGAGTACGACGAAGACGAAGCGCC
GGACGTAGACGAAGACGGGGCCAGCGAACGCCCCAGCGACGACGAACTGGCGGCGCTGGACGCGGAAGCG
GCTGATGACGGCGGCAAGGTCGCTGTGAACACCATCGAACAGGCCGATGACGAACCGGCAGCGGCTGAAT
TGGTGACTGGTGCATCGAGGCCTGGCGGCGGTTCTGTCGCCAAGCCTGAGCCGCAAGCGGAACCAGAACC
CGAACCGGATCGCGGGCTTGGTCATGACCAAGCCGACATTGAACCGGACGGGCCAACGGACGAAGACCTT
GCCGCAATGATGGAAGACTTCACGCCACCCGATGACGGGATGATGGATGAAGCCGACATGCTGGCCGCGC
TGGATGAAATGGAAGCGGTGCCGGAGTATGTCGAGGAAGCCGAAAACGACGCGCCCATACTCGATTTGAG
CGTGCTTGACAAGCCCCTTCCTTCAATCAAGAATGCGAAATAG
 Primer design