SecReT4
Protein ID: 167643947
T4SS name [ID]VirB [221]
Gene symbolvirB11
Locus tagpTer331_19
StrainCollimonas fungivorans Ter331
Repliconplasmid pTer331 [GenBank: NC_010332] [Browse all T4SS(s) in this replicon]
Location [Strand]20480..21580 [-]
Producthypothetical protein
Component typeVirB11
UniProt IDB0ZB74
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-65, Aligned region: 36..338
Protein Sequence: 366 a.a.     [Download]
>gi|167643947|ref|YP_001672045.1| hypothetical protein pTer331_19 [Collimonas fungivorans Ter331]
MPATWTFRVFTMSQRNNSNEYIASVDRAASVNYHLEFAKEWMEDPTITEICVNRPFEVFCERQNVWERHE
VPGLTQDHLLSLATATAKFSSNDVSENRPILSAIMPGGERVQIVLPPACEHGTVSVTIRKPSFNVRTLGD
YDKQGFFKHIKPLTSDLTEQEKELVRLKEDGNYIDFLRRAVQLEKVIVVAGETGSGKTTFMKALMQEIPA
DQRIITIEDVPELFLPSHPNHVHLFYPSEAKEEDNAPVTAAALLKSCLRMKPTRILLAELRSGETFDFIN
VAASGHGGSITSCHAGSCDLTFERLALMVLQNRQGRTLPYPVIRRLLYLVVDVVVHVHNDLTGGAGRHIT
ELWYDPMMKRAPAPKD
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|167643928|ref|NC_010332.1|:c21580-20480 Collimonas fungivorans plasmid pTer331, complete sequence
TTGCCCGCGACTTGGACTTTTCGAGTGTTTACGATGTCGCAGCGCAATAACAGCAACGAGTACATCGCTT
CCGTTGACCGGGCCGCCTCGGTCAATTACCACCTTGAATTTGCCAAGGAATGGATGGAAGACCCGACCAT
CACGGAAATCTGCGTGAACCGGCCGTTTGAGGTTTTCTGCGAGCGGCAAAACGTATGGGAACGGCACGAA
GTGCCGGGCCTGACGCAAGATCACTTGCTGTCGCTGGCAACGGCTACGGCCAAGTTTTCGAGCAACGACG
TTTCGGAAAACCGGCCGATTCTCTCGGCCATCATGCCGGGCGGTGAGCGCGTGCAAATCGTGCTGCCGCC
TGCGTGCGAGCATGGAACGGTGTCGGTCACGATCCGTAAGCCGTCCTTCAATGTCCGCACGCTGGGCGAC
TACGACAAGCAAGGCTTTTTCAAGCACATCAAGCCGCTGACCAGCGACTTGACGGAGCAAGAAAAGGAGT
TGGTGCGACTCAAGGAAGACGGCAACTACATCGACTTCCTGCGCCGTGCAGTCCAGCTCGAAAAAGTCAT
CGTGGTGGCCGGCGAAACCGGCTCGGGCAAGACCACCTTCATGAAGGCCTTGATGCAGGAAATTCCTGCT
GACCAGCGCATCATCACGATTGAGGACGTGCCCGAACTGTTCTTGCCAAGCCATCCGAACCACGTCCACC
TGTTCTATCCCAGCGAAGCCAAGGAAGAAGATAACGCGCCGGTCACGGCCGCCGCGCTTCTGAAAAGCTG
CCTGCGGATGAAGCCCACGCGCATCTTGCTTGCCGAGCTGCGCAGCGGTGAGACATTCGACTTCATCAAC
GTGGCCGCCTCGGGCCACGGTGGCAGCATCACAAGCTGCCATGCCGGATCGTGCGACCTGACGTTTGAAC
GGCTGGCCTTGATGGTGTTGCAGAACCGCCAGGGCCGCACGCTGCCTTACCCGGTGATTCGCCGGCTGCT
GTATCTGGTGGTCGATGTCGTCGTGCATGTCCACAACGATCTAACAGGCGGTGCAGGCCGGCACATTACC
GAACTTTGGTATGACCCGATGATGAAGCGCGCACCGGCTCCGAAGGACTAA
 Primer design