SecReT4
Protein ID: 167643950
T4SS name [ID]VirB [221]
Gene symbolvirB8
Locus tagpTer331_22
StrainCollimonas fungivorans Ter331
Repliconplasmid pTer331 [GenBank: NC_010332] [Browse all T4SS(s) in this replicon]
Location [Strand]23560..24270 [-]
ProductVirB8
Component typeVirB8
UniProt IDB0ZB77
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.6e-68, Aligned region: 21..230
Protein Sequence: 236 a.a.     [Download]
>gi|167643950|ref|YP_001672048.1| VirB8 [Collimonas fungivorans Ter331]
MFGKKPGVETPTDEKPVFEQAINWESSRVLSVEKSERRAWRVAFASVGVAVLAIAAIAMMMPLKESVPYV
IRVDNTTGVPDIVTAITDKAVTGDEVMDKYWLAQYVRARETYDWYTLQRDYNTVGLLSSANVGQGYAQLF
EGKDALDKTYGKTVRATVEILSVVPTGKNTGTVRFIKTTKRVDQEGSPGTVTKWVATVAYEYRSTALIKE
SARLVNPFGFQVLTYRVDPEMVGSVQ
 
Nucleotide Sequence: 711 bp     [Download]
>gi|167643928|ref|NC_010332.1|:c24270-23560 Collimonas fungivorans plasmid pTer331, complete sequence
ATGTTCGGAAAGAAACCTGGGGTGGAAACGCCCACTGACGAAAAACCTGTCTTCGAGCAGGCAATCAATT
GGGAGTCCTCGCGGGTGCTCTCCGTTGAAAAATCCGAACGCCGGGCATGGCGCGTTGCCTTCGCTTCGGT
TGGTGTTGCTGTCCTGGCGATTGCTGCCATCGCCATGATGATGCCGCTCAAAGAGTCGGTGCCTTACGTC
ATCCGCGTGGACAACACGACGGGCGTTCCCGACATCGTTACGGCCATCACCGATAAGGCGGTGACGGGCG
ATGAGGTCATGGATAAATACTGGCTCGCCCAATACGTGCGCGCCCGCGAAACCTATGACTGGTACACGCT
GCAACGCGACTACAACACGGTCGGCCTGTTGTCCTCGGCGAACGTCGGTCAGGGCTATGCCCAGCTCTTT
GAAGGCAAAGATGCCCTGGACAAGACCTATGGCAAGACGGTTCGCGCGACGGTCGAAATCCTGAGCGTGG
TTCCGACTGGCAAAAACACCGGGACGGTTCGCTTCATCAAGACGACGAAGCGCGTCGATCAGGAAGGCTC
GCCGGGCACGGTGACGAAGTGGGTCGCCACGGTGGCCTATGAGTACCGCAGCACGGCGCTTATCAAGGAA
AGTGCCCGACTGGTGAACCCCTTCGGCTTTCAAGTGCTGACCTACCGCGTTGACCCTGAAATGGTGGGGA
GCGTCCAATGA
 Primer design