SecReT4
Protein ID: 167643951
T4SS name [ID]VirB [221]
Gene symbolvirB7
Locus tagpTer331_23
StrainCollimonas fungivorans Ter331
Repliconplasmid pTer331 [GenBank: NC_010332] [Browse all T4SS(s) in this replicon]
Location [Strand]24276..24440 [-]
ProductVirB7
Component typeVirB7
UniProt IDB0ZB78
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 54 a.a.     [Download]
>gi|167643951|ref|YP_001672049.1| VirB7 [Collimonas fungivorans Ter331]
MKQAFVVLLVVALAGCATNKAVLPSLEGKPRVKINQQAPVPAAPAPVINETKGE
 
Nucleotide Sequence: 165 bp     [Download]
>gi|167643928|ref|NC_010332.1|:c24440-24276 Collimonas fungivorans plasmid pTer331, complete sequence
ATGAAGCAAGCATTTGTCGTCTTGTTGGTCGTCGCCCTTGCGGGCTGCGCGACTAACAAAGCGGTCTTGC
CTTCTCTCGAAGGCAAGCCCCGCGTCAAGATCAACCAGCAAGCGCCCGTTCCTGCGGCTCCTGCACCAGT
CATCAACGAAACCAAAGGGGAGTAA
 Primer design