SecReT4
Protein ID: 167644533
T4SS name [ID]Trb [266]
Gene symbol-
Locus tagCaul_0565
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]614633..615361 [-]
ProductIstB ATP-binding domain-containing protein
Component typeTrbB
UniProt IDB0T7E8
KEGG IDcak:Caul_0553, cak:Caul_0565
PDB IDNA
Domain hit(s) vs Pfam IstB_IS21 [PF01695], Evalue: 1.6e-56, Aligned region: 55..229
Bac_DnaA [PF00308], Evalue: 7.6e-07, Aligned region: 101..197
AAA_19 [PF13245], Evalue: 7.1e-05, Aligned region: 98..127
Protein Sequence: 242 a.a.     [Download]
>gi|167644533|ref|YP_001682196.1| IstB ATP-binding domain-containing protein [Caulobacter sp. K31]
MQRHEMIEVLGQLGLKGMAGAFDDAVTTGLQRNRTAMEMLSDLLRAETAHRQAASTRYRMTAAKLPVMKD
LSSYVFEGSPLNQGLVRSLHDGAFLANHRNVVLVGGTGTGKTHLAIAITANVVRAGARGRFFNLVDLVNR
LEDETRRGKAGTLAAQLSRLDLVVLDELGYLPFAQSGGQLLFHLISKLYERTSVIITTNLAFGEWPSVFG
DAKMTTALLDRLTHHCDIVETGNDSWRLKNRS
 
Nucleotide Sequence: 729 bp     [Download]
>gi|167643973|ref|NC_010338.1|:c615361-614633 Caulobacter sp. K31 chromosome, complete genome
ATGCAACGGCATGAGATGATCGAAGTCTTAGGGCAGCTGGGTTTGAAGGGCATGGCGGGCGCCTTCGACG
ACGCCGTCACCACAGGTCTGCAGCGCAACCGCACGGCCATGGAAATGCTGTCCGACCTGCTGAGGGCCGA
GACCGCCCACCGCCAGGCCGCCTCCACCCGCTATCGCATGACCGCCGCCAAGCTGCCGGTGATGAAGGAC
CTGTCGAGCTACGTCTTCGAGGGCTCGCCGCTCAATCAGGGCTTGGTCCGGTCGCTGCATGACGGCGCCT
TCCTGGCCAACCACCGCAACGTCGTGCTGGTCGGCGGCACCGGCACGGGCAAGACCCATCTCGCCATCGC
GATCACCGCCAACGTGGTCCGCGCCGGCGCCCGCGGCCGTTTCTTCAATCTCGTCGACCTAGTGAACCGG
CTCGAAGACGAGACCCGGCGCGGCAAGGCCGGAACGCTCGCCGCCCAGCTCTCACGGCTGGATCTCGTCG
TGCTCGACGAGCTGGGCTATCTGCCGTTTGCGCAATCCGGCGGCCAGCTGCTCTTCCACCTGATCAGCAA
GCTCTACGAGCGCACGTCGGTAATCATCACCACCAACCTGGCCTTCGGCGAATGGCCGAGCGTCTTCGGC
GACGCCAAGATGACCACGGCCCTGCTCGATCGGCTCACGCACCACTGCGACATCGTCGAGACCGGCAACG
ACAGCTGGCGGCTGAAGAATCGATCCTAA
 Primer design