SecReT4
Protein ID: 167645991
T4SS name [ID]Trb [266]
Gene symbol-
Locus tagCaul_2028
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]2171427..2171768 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB0T6U1
KEGG IDcak:Caul_2028
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-24, Aligned region: 15..102
Protein Sequence: 113 a.a.     [Download]
>gi|167645991|ref|YP_001683654.1| conjugal transfer protein TrbC [Caulobacter sp. K31]
MMFHRAASRAQRDPRPLLLTTTLTLLVSAQAQAAGSGMPWEEPLQQVLESVQGPVAKIIAVLVIISTGLA
LAFGETSGGFRKLIQIVFGLSIAFAASSFFLSFFSFGGGALIA
 
Nucleotide Sequence: 342 bp     [Download]
>gi|167643973|ref|NC_010338.1|:2171427-2171768 Caulobacter sp. K31 chromosome, complete genome
ATGATGTTTCATCGTGCTGCTTCGCGTGCGCAACGTGATCCGCGCCCGCTGCTTTTGACCACCACCCTGA
CCCTGCTGGTCAGCGCTCAGGCCCAGGCCGCCGGTTCGGGCATGCCCTGGGAAGAGCCGCTTCAGCAAGT
CCTGGAGTCCGTTCAGGGACCCGTCGCCAAGATCATCGCCGTGCTGGTGATCATCAGCACCGGTCTGGCC
CTGGCCTTCGGCGAGACCAGCGGCGGCTTTCGCAAGCTGATCCAGATCGTCTTCGGGCTCAGCATCGCCT
TCGCCGCCTCCAGCTTCTTCCTGTCGTTCTTCAGCTTCGGCGGCGGGGCCCTGATCGCATGA
 Primer design