SecReT4
Protein ID: 167645995
T4SS name [ID]Trb [266]
Gene symbol-
Locus tagCaul_2032
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]2175247..2176596 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB0T6U5
KEGG IDcak:Caul_2032
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3e-44, Aligned region: 40..264
Protein Sequence: 449 a.a.     [Download]
>gi|167645995|ref|YP_001683658.1| conjugal transfer protein TrbL [Caulobacter sp. K31]
MDVAPDLNIIDRMMAAFIAYIDSGFGLLGPHVNSMSTVLIALDVTLAALWWALEGDDNVLGRLIKKVLYV
GAFAFILNNFKSLTEAIFKSFAQLGVTAGGGGVSTEDLLRPGKLASVGFTAAHPLLDKASQLMGFPEFFA
NALTIFVLLLAWVLVVLAFFVMAIQLLVTVLEFKLTCLAGFSLVPFAFWNKSSFLAERVLGNVISSGVKV
MVLGVIVGIGASFFDTFLASLGSDPDLSAAMTLVLGALTLAGLSIFGPAIASGLVSGAPQLGAGAAVGTA
AGAAMLGGGAAMLGARALGMAGAGGLAAVRAGASMGAGASAAYQLRQATSGATGMAGVASGLSGVGRAVG
GAAINGVRDMAGRAGSALQESAQSGRAAAWKATGGSSPVSGGGEAPAPGAQAASASTPPAWAKNLRPNHA
GMGHHAAVQTLKEGDRPGAPANPDLSQED
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|167643973|ref|NC_010338.1|:2175247-2176596 Caulobacter sp. K31 chromosome, complete genome
GTGGACGTCGCGCCCGACCTCAACATCATCGACCGCATGATGGCGGCCTTCATCGCCTACATCGACAGCG
GCTTTGGGCTGCTGGGACCGCACGTCAATTCGATGTCCACGGTCCTAATCGCCCTGGACGTCACCCTGGC
GGCGCTCTGGTGGGCGCTGGAAGGCGACGACAACGTCCTGGGCCGACTGATCAAGAAGGTCCTCTATGTC
GGGGCCTTCGCCTTCATCCTGAACAACTTCAAATCGCTCACCGAGGCGATCTTCAAGTCGTTCGCCCAAC
TCGGCGTGACGGCTGGGGGCGGCGGCGTCTCGACCGAGGATCTGCTGCGTCCGGGCAAGCTGGCCAGCGT
CGGCTTCACCGCCGCCCATCCGTTGCTGGACAAGGCCAGTCAGTTGATGGGCTTTCCGGAGTTCTTCGCC
AATGCCCTGACGATCTTCGTGCTGCTGCTGGCCTGGGTGCTGGTGGTCCTGGCCTTCTTCGTCATGGCCA
TCCAGCTTCTGGTCACGGTCCTGGAGTTCAAGCTGACCTGCCTGGCCGGCTTTTCACTGGTCCCCTTCGC
CTTCTGGAACAAGTCGAGTTTCCTGGCCGAGCGCGTGCTGGGCAACGTCATCTCCAGCGGCGTCAAGGTC
ATGGTCCTGGGGGTGATCGTCGGCATCGGGGCCAGCTTCTTCGACACCTTCCTGGCCTCGCTCGGCTCAG
ATCCGGACCTTTCGGCGGCCATGACCTTGGTCCTGGGCGCCCTGACCTTGGCCGGCCTGTCGATCTTCGG
CCCGGCGATCGCCTCGGGCCTGGTCTCCGGCGCGCCCCAGCTGGGCGCGGGCGCTGCGGTCGGCACCGCA
GCCGGCGCGGCCATGCTGGGCGGCGGCGCCGCCATGCTCGGCGCCCGCGCGCTGGGCATGGCCGGCGCGG
GCGGCCTGGCGGCGGTGCGTGCCGGCGCCTCGATGGGCGCGGGCGCCAGCGCCGCCTATCAGCTTCGCCA
AGCCACGTCCGGCGCCACGGGCATGGCGGGTGTCGCGTCGGGCCTGAGCGGCGTTGGCCGAGCGGTCGGC
GGCGCGGCGATCAACGGCGTGCGCGACATGGCCGGCCGCGCTGGCTCGGCCCTGCAGGAGAGCGCCCAGA
GTGGCCGGGCAGCAGCGTGGAAGGCGACCGGCGGCTCGAGTCCTGTGTCGGGCGGCGGCGAGGCGCCCGC
TCCCGGCGCCCAGGCGGCGTCCGCGTCGACCCCGCCAGCCTGGGCCAAGAACCTGCGGCCCAACCACGCC
GGCATGGGTCACCACGCCGCCGTTCAAACCCTCAAGGAGGGCGACCGTCCCGGCGCCCCCGCCAACCCCG
ATCTCAGCCAGGAGGATTGA
 Primer design