SecReT4
Protein ID: 167645997
T4SS name [ID]Trb [266]
Gene symbol-
Locus tagCaul_2034
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]2177382..2178365 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB0T6U7
KEGG IDcak:Caul_2034
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.3e-69, Aligned region: 98..317
Protein Sequence: 327 a.a.     [Download]
>gi|167645997|ref|YP_001683660.1| P-type conjugative transfer protein TrbG [Caulobacter sp. K31]
MTAKTLLPMACACALSACAHPKTPPPAIAYDAAAFVPAKVAPEPPKPVEIVEIPKPLPLPGQLLPPPTVR
SEPVSPRGRIDAANRAATQEPTTAGYINAVQVYPWTDGALYRLYTAPERVSDIVLEPGEQLIAVSAGDTV
RWIIGDTTSGAGEGRQVHLLVKPFAAGLTTNMVITTDRRTYHLALSSTDATAMAAVSWTYPQDRLLALRR
QNAAAAAAAPAADNVAVEQLRFRYAITGDMPPWRPVRVFDDGQKVYIEFPARLDQGEAPPLFVVGPLGES
QLVNYRVRGNRYIVDRLFAAAELRLGQAPQQVVRISRTDTPNAGAKS
 
Nucleotide Sequence: 984 bp     [Download]
>gi|167643973|ref|NC_010338.1|:2177382-2178365 Caulobacter sp. K31 chromosome, complete genome
ATGACCGCCAAGACCTTGCTTCCGATGGCGTGCGCCTGCGCCTTGAGCGCCTGCGCCCATCCCAAGACCC
CGCCGCCCGCCATCGCCTATGATGCGGCGGCCTTCGTTCCGGCCAAGGTTGCGCCCGAGCCGCCCAAGCC
GGTGGAGATCGTCGAAATCCCCAAGCCGTTGCCCTTGCCGGGCCAGTTGCTGCCGCCGCCGACCGTGCGC
TCCGAGCCGGTCTCGCCGCGCGGCCGGATCGACGCGGCCAATCGCGCCGCGACGCAGGAGCCGACCACGG
CGGGCTACATCAACGCGGTGCAGGTCTATCCCTGGACCGACGGAGCGCTCTACCGGCTCTATACCGCGCC
CGAGCGGGTCAGCGACATCGTGCTCGAACCGGGTGAACAGCTGATCGCCGTCTCGGCGGGCGACACCGTC
CGCTGGATCATCGGCGACACCACCAGCGGGGCAGGGGAGGGCCGCCAGGTCCACCTGCTCGTCAAGCCCT
TCGCCGCCGGCCTGACCACCAACATGGTGATCACCACCGATCGCCGGACCTATCATTTGGCCCTGAGCAG
CACTGACGCCACGGCGATGGCGGCGGTCTCCTGGACCTATCCTCAGGATCGCCTGTTGGCGCTGAGGCGG
CAAAACGCGGCCGCCGCAGCCGCCGCGCCGGCCGCCGACAATGTCGCCGTCGAGCAGCTTCGATTCCGCT
ACGCCATCACCGGGGATATGCCGCCCTGGCGGCCGGTCCGGGTCTTCGACGACGGCCAAAAGGTCTATAT
TGAGTTTCCCGCTCGCCTGGACCAGGGCGAAGCGCCGCCGCTGTTCGTTGTCGGCCCCTTGGGCGAGAGC
CAGCTCGTCAATTATCGGGTTCGCGGCAACCGCTACATCGTCGACAGGCTGTTCGCCGCCGCCGAACTGC
GTTTGGGCCAGGCGCCCCAGCAGGTGGTTCGCATCAGTCGCACCGATACGCCCAATGCGGGAGCCAAGTC
ATGA
 Primer design