SecReT4
Protein ID: 167646216
T4SS name [ID]Trb [267]
Gene symbol-
Locus tagCaul_2254
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]2448276..2449004 [-]
ProductIstB ATP-binding domain-containing protein
Component typeTrbB
UniProt IDB0SXT4
KEGG IDcak:Caul_2254, cak:Caul_4172, cak:Caul_5399
PDB IDNA
Domain hit(s) vs Pfam IstB_IS21 [PF01695], Evalue: 9.1e-56, Aligned region: 55..229
Bac_DnaA [PF00308], Evalue: 2.1e-08, Aligned region: 101..197
AAA_19 [PF13245], Evalue: 8.9e-05, Aligned region: 99..125
Protein Sequence: 242 a.a.     [Download]
>gi|167646216|ref|YP_001683879.1| IstB ATP-binding domain-containing protein [Caulobacter sp. K31]
MQRHEMIEALGQLGLKGMAGAFDETVTTGLQRNRTAMEILADLLKAETNHRQAASIRYRLTAAKLPVMKD
LAAFSFEGSPINEGLVRSLYDGAFLANHRNIVLVGGTGTGKTHLAIAITANVVRSGARGRYFNTVDLVNR
LEDEARRGKAGALAAQLSRLDLVVLDELGYLPFAQSGGQRLFHLVSKLYERTSVIITTNLTFAEWPTVFG
DAKMTTALLDRLTHHCDIVETGNDSWRLRNRA
 
Nucleotide Sequence: 729 bp     [Download]
>gi|167643973|ref|NC_010338.1|:c2449004-2448276 Caulobacter sp. K31 chromosome, complete genome
GTGCAGCGGCATGAGATGATCGAGGCCCTGGGCCAACTGGGTCTGAAGGGCATGGCCGGGGCCTTCGACG
AGACCGTCACCACGGGCCTTCAGCGCAACCGCACGGCCATGGAGATCCTGGCCGACCTGCTCAAGGCCGA
GACCAACCATCGCCAGGCCGCCTCCATCCGTTATCGCCTGACCGCCGCCAAGCTGCCGGTGATGAAGGAC
CTGGCGGCGTTCAGCTTCGAGGGCTCGCCGATCAATGAGGGCTTGGTCCGTTCGCTATACGACGGCGCCT
TCCTGGCCAACCATCGCAACATCGTCCTGGTCGGCGGCACCGGCACCGGCAAGACCCACCTGGCCATCGC
CATCACCGCCAACGTCGTGCGCTCTGGCGCTCGTGGCCGCTACTTCAACACCGTCGATCTGGTGAACCGG
CTTGAGGACGAGGCCCGGCGCGGCAAGGCCGGCGCTTTAGCCGCCCAGCTCTCGCGCCTGGACCTCGTGG
TGCTCGACGAGCTGGGCTACCTGCCGTTCGCCCAGTCTGGCGGCCAGCGCCTGTTCCACCTGGTCAGCAA
GCTCTACGAGCGCACCTCGGTGATCATCACCACCAACCTGACCTTCGCAGAATGGCCCACCGTCTTCGGC
GACGCCAAGATGACCACGGCGCTGCTCGACCGCCTGACCCATCACTGCGACATCGTCGAGACGGGCAACG
ACAGCTGGCGGCTCAGGAACCGGGCCTGA
 Primer design