SecReT4
Protein ID: 167646231
T4SS name [ID]Trb [267]
Gene symbol-
Locus tagCaul_2269
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]2467365..2467736 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB0T8Q3
KEGG IDcak:Caul_2269
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-22, Aligned region: 28..113
Protein Sequence: 123 a.a.     [Download]
>gi|167646231|ref|YP_001683894.1| conjugal transfer protein TrbC [Caulobacter sp. K31]
MSVQSARSLRARLLSGSMLDPLGHVAHLAPLTLAALLTGRSAQAAGSSMPWEEPLQRILESIEGPVAKII
AVIIIIVTGLTLAFGDTSGGSRKLIQIVFGLSIAFAASSFFLSFFSFGGGAVI
 
Nucleotide Sequence: 372 bp     [Download]
>gi|167643973|ref|NC_010338.1|:2467365-2467736 Caulobacter sp. K31 chromosome, complete genome
ATGTCCGTCCAATCCGCACGTTCCCTGCGCGCGCGCCTGCTGTCCGGATCAATGCTCGATCCCCTGGGCC
ACGTCGCCCATTTGGCGCCGCTGACCCTTGCCGCGCTGCTGACCGGTCGATCGGCCCAAGCGGCTGGCTC
GTCCATGCCCTGGGAGGAACCGCTGCAGCGGATCCTGGAGTCGATCGAAGGTCCCGTCGCCAAGATCATC
GCGGTGATCATCATCATCGTCACCGGCCTGACCCTGGCTTTTGGCGACACCTCCGGCGGCTCGCGAAAGC
TGATCCAGATCGTCTTCGGGCTGTCGATCGCCTTCGCCGCTTCCAGCTTCTTCCTCTCGTTCTTCTCGTT
CGGCGGCGGGGCGGTGATCTGA
 Primer design