SecReT4
Protein ID: 167646235
T4SS name [ID]Trb [267]
Gene symbol-
Locus tagCaul_2273
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]2471404..2472660 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB0T8Q7
KEGG IDcak:Caul_2273
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3e-46, Aligned region: 38..260
Protein Sequence: 418 a.a.     [Download]
>gi|167646235|ref|YP_001683898.1| conjugal transfer protein TrbL [Caulobacter sp. K31]
MSDTGVIDRMLDVYTQHIDSGFGLLGGEVAFLSTTLVAIDMTLAALFWAWAQDDVTARLVKKTLYVGFFA
FLIGNFHALSLVVLKSFSGLGLKASGAGISADDFLRPGKLAALGISSCKPILQAASELGGFPGFFENIVQ
IVILLAVALLVIVAFFVIAVQIFVVLIEFKLATLAGFVLVPFGLFGRTAFLAERVLGAVIASGVKVMVLA
VIVGIGSSLFSEFNSTAAGQPTLEEVLAMALAALTLLGLSIFGPGIASGLVSGAPQLGAGAAVGTGLTVA
GMAIVGAGAAQMAMRGGAGLATAASAAGGAGGPRPGPGEPAPSGPGGGPGPGAGPGGGSPQPAGSAPPAG
SNTSSGGGSGSGSAPANPSEAPAAEAPAWARDLKQQQALAHGASLAAHGLASGDDHSGGASPSLSEQS
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|167643973|ref|NC_010338.1|:2471404-2472660 Caulobacter sp. K31 chromosome, complete genome
ATGAGCGACACCGGCGTCATCGACCGGATGCTGGACGTCTACACCCAGCACATCGACAGCGGCTTTGGCC
TGCTGGGCGGCGAGGTTGCGTTCCTCTCCACCACCCTGGTGGCCATCGACATGACCCTGGCGGCGCTGTT
CTGGGCCTGGGCCCAGGACGACGTCACCGCGCGCCTGGTCAAGAAGACGCTCTATGTCGGCTTCTTCGCC
TTCCTGATCGGCAACTTCCACGCGCTCAGCCTGGTGGTGCTCAAGAGCTTCTCGGGGCTGGGCCTGAAAG
CCTCGGGCGCGGGGATCTCGGCCGACGACTTCCTGCGGCCAGGCAAGTTGGCGGCGCTCGGGATCTCGTC
GTGCAAGCCCATCCTGCAGGCGGCCAGCGAGCTGGGCGGCTTTCCCGGCTTTTTCGAAAACATCGTCCAG
ATCGTGATCCTCCTGGCCGTGGCCCTTCTGGTCATCGTCGCCTTCTTCGTGATCGCGGTGCAGATCTTCG
TGGTCTTGATCGAGTTCAAGCTGGCCACCCTGGCCGGGTTCGTCCTCGTCCCGTTTGGCCTGTTCGGACG
CACCGCCTTCCTGGCCGAACGCGTCCTGGGGGCGGTCATCGCCTCGGGTGTCAAGGTCATGGTCCTGGCG
GTCATCGTCGGGATCGGCTCGAGCCTTTTCTCGGAATTCAACAGCACCGCTGCGGGCCAGCCGACCCTTG
AAGAGGTCCTGGCCATGGCCTTGGCGGCTCTGACGCTCCTGGGCCTGTCGATCTTCGGGCCGGGCATCGC
CTCGGGCCTGGTGTCGGGCGCGCCGCAGCTGGGCGCCGGCGCGGCGGTCGGCACCGGCCTCACCGTGGCG
GGCATGGCCATAGTCGGGGCCGGCGCGGCGCAGATGGCGATGCGCGGCGGGGCCGGTCTCGCCACGGCGG
CTTCCGCCGCTGGCGGCGCTGGCGGTCCGCGTCCTGGACCGGGCGAGCCAGCCCCCAGCGGCCCAGGCGG
TGGCCCCGGCCCGGGTGCGGGCCCAGGTGGCGGATCGCCGCAGCCGGCCGGCAGCGCGCCGCCCGCTGGA
TCCAATACCTCAAGCGGCGGCGGGTCCGGCTCCGGCTCGGCGCCGGCCAACCCGAGCGAGGCCCCCGCCG
CCGAGGCGCCGGCCTGGGCGCGTGATCTCAAGCAACAACAGGCCTTGGCCCATGGCGCGAGCCTGGCCGC
CCACGGCCTGGCCAGCGGCGACGACCACAGCGGCGGCGCCAGTCCTTCTCTCTCGGAGCAAAGCTGA
 Primer design