SecReT4
Protein ID: 167646237
T4SS name [ID]Trb [267]
Gene symbol-
Locus tagCaul_2275
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]2473343..2474143 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB0T8Q9
KEGG IDcak:Caul_2275
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.3e-55, Aligned region: 38..257
Protein Sequence: 266 a.a.     [Download]
>gi|167646237|ref|YP_001683900.1| P-type conjugative transfer protein TrbG [Caulobacter sp. K31]
MTRAIVAIALAGFVTPAAGLASPPRKAAERPVEAVAATEYLFAERGVFELLAAPGWITDIVLEPGETLVE
TNPIAAGDTVRWIIGDNASGEGASRRVHVLVKPATAGLSTNLIINTNRRSYHLRMRASPRAYLSQVAWRY
PPAANVGPTIPVRPADLAPPPVPPAPAHINLGYRIKGAARWRPERAYDDGARTFVEFGRAIALSDMPPLY
VLGVDGKTSELVNYRVDGRRLVVDRLFDRAELRFGLRRWERRVRIERTTPPQEVGQ
 
Nucleotide Sequence: 801 bp     [Download]
>gi|167643973|ref|NC_010338.1|:2473343-2474143 Caulobacter sp. K31 chromosome, complete genome
ATGACCCGGGCGATCGTCGCGATCGCATTGGCCGGGTTTGTGACCCCCGCGGCCGGCTTGGCGTCTCCGC
CCCGCAAGGCTGCCGAACGGCCGGTGGAGGCGGTGGCGGCCACCGAATATCTCTTCGCCGAGCGCGGCGT
GTTCGAACTTCTCGCCGCGCCGGGCTGGATCACCGACATCGTGTTGGAGCCCGGGGAGACTCTGGTCGAG
ACCAATCCGATCGCCGCCGGCGACACCGTCCGTTGGATCATCGGCGACAATGCGAGCGGGGAGGGCGCGA
GCCGCCGGGTCCACGTCCTGGTCAAGCCGGCGACGGCGGGTCTGTCGACCAACCTGATCATCAACACCAA
CCGGCGCAGCTATCACCTGCGGATGCGCGCCTCGCCGCGCGCCTATCTCTCGCAGGTGGCTTGGCGCTAT
CCGCCGGCGGCGAACGTGGGGCCGACGATCCCAGTCAGGCCGGCGGACCTTGCGCCGCCGCCTGTTCCGC
CTGCGCCAGCGCACATCAACCTCGGCTATCGGATCAAGGGAGCGGCGCGCTGGCGACCAGAGCGCGCCTA
TGACGACGGCGCGCGGACCTTTGTCGAGTTTGGCCGCGCCATCGCGCTGTCGGACATGCCGCCGCTCTAT
GTCCTCGGCGTCGACGGCAAGACCTCGGAGCTGGTCAACTATCGCGTCGATGGCCGCCGGCTGGTGGTTG
ATCGCCTGTTCGACCGGGCCGAGCTGCGTTTTGGCCTCAGGCGGTGGGAGCGGCGCGTCCGGATCGAGCG
AACGACGCCGCCACAGGAGGTCGGCCAATGA
 Primer design