SecReT4
Protein ID: 167647782
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3821
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4140541..4141086 [+]
Productputative conjugal transfer protein
Component typeTraF
UniProt IDB0SV57
KEGG IDcak:Caul_3821
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 4.6e-56, Aligned region: 29..166
Protein Sequence: 181 a.a.     [Download]
>gi|167647782|ref|YP_001685445.1| putative conjugal transfer protein [Caulobacter sp. K31]
MTRLAYVMTTYAAVFTTVALSFLHVAPRLIWNASASTPIGLYSIGPAGHLEVTDLVAVDAPEPLARFLAD
GGYLPRGVPLMKRVVALPGQEVCRIGRDIMVDGIAIGSALARDHRGRELPVWQGCRRIADGEVFLMNWQV
RDSLDGRYFGPIPASAIIGQALPVWTDERGDGRYVWRAPTR
 
Nucleotide Sequence: 546 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4140541-4141086 Caulobacter sp. K31 chromosome, complete genome
ATGACGCGCCTCGCCTACGTCATGACGACCTACGCAGCCGTGTTCACGACCGTCGCACTGTCGTTCCTCC
ATGTCGCGCCCAGACTGATCTGGAATGCGTCGGCCAGCACGCCGATCGGGCTCTATTCCATTGGTCCCGC
CGGTCATCTGGAAGTGACGGATCTCGTCGCCGTCGATGCGCCGGAGCCGCTCGCCCGTTTCCTCGCCGAT
GGCGGTTATCTACCGCGCGGCGTGCCGCTGATGAAGCGCGTCGTCGCCCTTCCGGGGCAAGAGGTCTGTC
GCATCGGCCGCGACATCATGGTCGATGGCATCGCCATCGGCAGCGCGCTGGCGCGCGATCATCGCGGTCG
TGAGCTTCCGGTTTGGCAAGGCTGCCGCCGCATCGCCGATGGCGAAGTCTTCCTGATGAACTGGCAGGTC
CGCGACAGCCTCGATGGCCGCTATTTCGGACCAATCCCGGCCAGCGCGATCATCGGCCAGGCGCTGCCTG
TGTGGACCGATGAGCGCGGCGACGGCCGCTACGTCTGGCGCGCGCCGACACGGTGA
 Primer design