SecReT4
Protein ID: 167647784
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3823
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4141472..4142404 [+]
Productlytic transglycosylase catalytic subunit
Component typeTrbN
UniProt IDB0SV59
KEGG IDcak:Caul_3823
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 310 a.a.     [Download]
>gi|167647784|ref|YP_001685447.1| lytic transglycosylase catalytic subunit [Caulobacter sp. K31]
MRDPSTFARVTACAKFIPLFAGKPSHPSVPLDDQSAIARSEGQGRPSAGARALPLTEASTVASCRRRGGG
TPVHIAILLLVGISFTAIEPAAALAQNRSIERPSSPDPYADFIAEASQRFGIPTAWIRAIMRVESANDVR
AISPKGAMGLMQIMPATWADLRARHRLGDNPYDPRDNILAGAAYLRELHDRYGSPGFLAAYNAGPGRYEE
YVATGRALPAETRAYVAVLTPLVGDGATTGPITVATVDPLAWVRAPLFIGRNERIAAADPVQPDRSSIDA
PTAIPVRDPAAIAPQSDGLFVARSERRGPQ
 
Nucleotide Sequence: 933 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4141472-4142404 Caulobacter sp. K31 chromosome, complete genome
ATGCGAGACCCAAGCACGTTCGCACGCGTGACGGCCTGCGCGAAGTTCATCCCTTTGTTCGCGGGAAAGC
CGTCTCATCCCTCCGTCCCGCTCGACGACCAGTCGGCCATCGCGCGCAGCGAAGGTCAGGGGCGGCCATC
GGCCGGCGCTCGCGCCTTGCCCTTGACCGAAGCGAGCACGGTGGCAAGCTGCCGTCGTCGTGGAGGCGGA
ACGCCGGTTCATATCGCGATCCTTTTGCTGGTCGGGATCTCGTTCACGGCGATCGAGCCCGCCGCCGCGC
TTGCACAGAACAGGTCGATCGAGCGGCCTTCGTCCCCCGATCCCTATGCCGACTTCATCGCCGAAGCCTC
GCAGCGCTTCGGCATTCCGACAGCCTGGATTCGCGCCATCATGCGCGTCGAAAGCGCCAACGACGTGCGC
GCTATCTCGCCCAAAGGCGCGATGGGATTGATGCAGATCATGCCCGCGACCTGGGCCGATCTGCGCGCCC
GCCATCGGCTTGGCGACAATCCGTATGATCCGCGTGACAACATCCTGGCCGGCGCTGCCTATCTTCGTGA
ACTGCACGATCGCTACGGATCGCCCGGCTTCCTCGCCGCCTACAATGCAGGCCCCGGCCGCTACGAGGAA
TATGTCGCGACCGGCCGCGCGTTGCCCGCCGAGACCCGCGCCTATGTCGCCGTCCTCACTCCGCTTGTCG
GCGATGGCGCGACAACTGGACCGATCACGGTGGCGACCGTCGATCCGCTCGCCTGGGTCCGTGCGCCGCT
CTTCATCGGGCGCAACGAACGCATCGCGGCCGCCGATCCTGTGCAACCGGATCGTTCGTCGATTGACGCT
CCAACCGCCATCCCGGTGCGCGATCCCGCTGCCATCGCGCCGCAGTCCGATGGCCTGTTCGTCGCGCGAT
CCGAACGGCGAGGACCGCAATGA
 Primer design