SecReT4
Protein ID: 167647786
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3825
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4144420..4146420 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDB0SV61
KEGG IDcak:Caul_3825
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.5e-101, Aligned region: 111..556
TraG-D_C [PF12696], Evalue: 2e-30, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 1.4e-27, Aligned region: 170..536
AAA_10 [PF12846], Evalue: 2.9e-05, Aligned region: 372..478
Protein Sequence: 666 a.a.     [Download]
>gi|167647786|ref|YP_001685449.1| conjugal transfer coupling protein TraG [Caulobacter sp. K31]
MSATKILWGQILTVFLIVLLTTWTATEWTAWRLGFQAQLGHPWFELFGWPVYYPPAFFWWWYFYDAYAPP
IFVEGAYIAASGGFISIAVAIGMSVWRAREAKNAETFGSARWARLEEVRSAGLLGADGVVLGKMDRDYLR
HDGPEHILCFAPTRSGKGVGLVVPSLLTWPGSAIIHDIKGENWQLTAGFRARHGRVLLFDPTNAKSAAYN
PLLEVRRGEWEVRDVQNIADILVDPEGSLEKRNHWEKTSHALLVGAILHVLYAEEDKTLAGVAGFLSDPK
RPIESTLAAMMKTAHLGEAGPHPVIASAARELLNKSDNERSGVLSTAMSFLGLYRDPVVAEVTRRCDWRI
ADIVGGKHPTSLYLVVPPSDINRTKPLIRLILNQVGRRLTEDLQAKVGRHRLLLMLDEFPALGRLDFFES
ALAFMAGYGLKAFLIAQSLNQIERAYGPNNSILDNCHVRVSFATNDERTAKRVSDALGTATEMRAMRNYA
GHRLSPWLGHLMVSRSETARPLLTPGEVMQLPPADEIVMVAGTPPIRARKARYFEDRRLQERVLAPPKLI
KPETGMADDWSKLPLPARPVAALTGAAANIHSDGDGDEDATGSERRHQPELERASPVEKKAPIENEFEVG
VDDDPEEDAARISRANQVMQGVARQVSLDLNDGMDL
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4144420-4146420 Caulobacter sp. K31 chromosome, complete genome
ATGTCCGCCACCAAAATTCTCTGGGGCCAGATCCTCACCGTCTTCCTGATCGTCCTCCTCACCACCTGGA
CCGCGACCGAATGGACCGCGTGGCGGCTCGGCTTTCAGGCGCAGCTCGGCCACCCGTGGTTCGAGCTGTT
CGGCTGGCCGGTCTATTATCCACCAGCCTTCTTCTGGTGGTGGTATTTCTACGATGCCTATGCGCCACCG
ATCTTCGTCGAGGGGGCCTATATCGCGGCGTCCGGCGGCTTCATCTCGATCGCGGTGGCGATCGGCATGT
CGGTGTGGCGGGCGCGCGAGGCGAAGAATGCCGAGACCTTCGGCTCGGCGCGCTGGGCTCGCCTTGAGGA
GGTACGGTCCGCGGGCCTGCTCGGCGCCGATGGCGTGGTGCTCGGCAAGATGGACCGCGACTATCTGCGC
CACGATGGACCCGAGCACATTCTTTGCTTTGCGCCGACGCGCTCGGGCAAGGGCGTCGGCCTGGTCGTGC
CATCACTGCTGACCTGGCCGGGCTCCGCCATCATTCACGACATCAAGGGCGAGAACTGGCAGCTCACCGC
CGGCTTCCGCGCCCGCCACGGCCGCGTACTGCTGTTCGACCCGACCAACGCCAAGTCGGCCGCCTATAAC
CCGCTGCTGGAGGTTCGACGTGGCGAATGGGAAGTCCGCGACGTGCAGAATATCGCCGACATTCTGGTCG
ACCCCGAAGGCAGTCTTGAGAAGCGGAACCACTGGGAAAAAACCAGCCACGCGCTGCTGGTCGGCGCGAT
CCTCCACGTCCTCTATGCCGAGGAAGACAAGACACTCGCCGGCGTCGCCGGCTTCCTCTCCGATCCAAAG
CGGCCGATTGAATCGACGCTCGCGGCGATGATGAAGACCGCCCATCTCGGCGAGGCCGGCCCGCATCCTG
TCATCGCCAGTGCGGCCCGCGAGTTGCTGAACAAGTCCGACAACGAACGATCCGGCGTACTCTCGACCGC
CATGTCGTTCCTGGGATTGTATCGCGATCCCGTCGTCGCGGAGGTGACGCGGCGCTGCGACTGGCGCATC
GCCGACATTGTCGGCGGCAAGCACCCGACCAGTCTCTACCTCGTGGTGCCGCCCTCGGACATCAACCGCA
CCAAGCCGCTCATCCGCCTGATCCTCAATCAGGTTGGTCGCCGGCTGACGGAGGACCTGCAGGCGAAGGT
CGGCCGTCATCGCCTGCTGCTGATGCTCGACGAGTTTCCGGCGCTTGGCCGGCTCGACTTCTTCGAGTCC
GCGCTCGCCTTCATGGCAGGCTATGGCCTGAAAGCCTTTTTGATCGCCCAATCGCTGAACCAGATCGAGA
GGGCCTACGGCCCCAACAATTCCATCCTCGACAACTGCCATGTGCGCGTCAGCTTCGCCACCAACGATGA
GCGCACCGCCAAACGCGTTTCCGATGCGCTCGGCACCGCGACGGAGATGCGGGCGATGCGTAACTATGCC
GGCCATCGTCTCTCGCCCTGGCTCGGCCACCTGATGGTGTCCCGCTCGGAAACCGCGCGGCCTCTGCTCA
CTCCCGGCGAGGTCATGCAGCTCCCGCCGGCCGACGAAATCGTCATGGTCGCCGGAACGCCGCCGATCCG
CGCTAGGAAGGCGCGCTACTTCGAGGATCGGCGACTTCAGGAGCGGGTCCTGGCGCCTCCCAAACTCATC
AAGCCAGAGACGGGCATGGCGGACGACTGGAGCAAGCTGCCGCTCCCGGCTCGCCCGGTTGCCGCCCTGA
CCGGCGCAGCGGCCAACATTCATAGCGATGGTGATGGCGATGAAGACGCCACGGGTTCCGAACGTCGCCA
TCAGCCCGAACTGGAGCGCGCGAGCCCCGTCGAGAAGAAGGCGCCGATCGAGAACGAGTTCGAGGTCGGC
GTGGACGACGATCCCGAGGAAGACGCCGCGCGGATCAGCCGGGCGAACCAGGTGATGCAAGGCGTCGCCC
GCCAGGTCTCGCTCGATCTTAACGACGGCATGGACCTGTGA
 Primer design