SecReT4
Protein ID: 167647788
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3827
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4147079..4148044 [+]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDB0SV63
KEGG IDcak:Caul_3827
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.1e-86, Aligned region: 9..274
TrwB_AAD_bind [PF10412], Evalue: 3.5e-05, Aligned region: 129..167
FtsK_SpoIIIE [PF01580], Evalue: 6.6e-05, Aligned region: 125..161
Protein Sequence: 321 a.a.     [Download]
>gi|167647788|ref|YP_001685451.1| P-type conjugative transfer ATPase TrbB [Caulobacter sp. K31]
MLRTALGPAIAEFLDDPSVVEVMLNPDGRLWIDCLSEGLSDTGERLSPADGERIIRLVAHHVGAEVHSGA
PRVSAELPETGERFEGLLPPVVAAPAFAIRKPAVAVFTLSDYVAAGIMVASQAEVLRQAVAERRNILVAG
GTSTGKTTLTNALLAEVAKTSDRVVLIEDTRELQCAAPNLVALRTKDGVASLSDLVRSSLRLRPDRIPIG
EVRGPEALDLLKAWGTGHPGGVGTIHAGTAIGALRRLEQLIQEAVVTVPRALIAETIDIVAVLSGRGSQR
RLAELARVEGLGPSGDYQIKPADAASAVFPPATPDLSGDPA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4147079-4148044 Caulobacter sp. K31 chromosome, complete genome
ATGTTGCGCACAGCTCTTGGCCCCGCCATCGCCGAATTTCTGGACGACCCGTCCGTCGTCGAGGTGATGC
TCAACCCCGATGGGCGTCTCTGGATCGACTGCCTTTCCGAAGGTCTGTCTGACACCGGCGAACGACTGTC
GCCCGCCGATGGCGAACGGATCATCCGCCTCGTCGCCCATCATGTCGGCGCCGAAGTTCATTCCGGCGCG
CCGCGCGTCTCCGCGGAGCTGCCCGAGACGGGGGAGCGGTTCGAGGGGCTTCTGCCTCCTGTGGTGGCGG
CCCCGGCCTTCGCGATCCGCAAGCCCGCCGTCGCCGTGTTCACGCTCAGCGATTACGTGGCCGCCGGCAT
CATGGTGGCCTCACAAGCCGAGGTGCTGCGGCAGGCCGTCGCCGAGCGTCGCAACATCCTCGTCGCGGGT
GGGACATCGACCGGCAAGACGACGCTGACCAATGCGCTGCTGGCCGAGGTCGCCAAGACCTCCGACCGCG
TCGTGCTGATCGAGGACACGCGCGAGCTGCAATGCGCCGCGCCCAATCTGGTCGCGCTGCGCACCAAGGA
TGGCGTCGCCTCGCTCTCCGATCTTGTCCGCTCCTCGCTTCGCCTTCGGCCCGATCGCATTCCGATCGGC
GAGGTTCGCGGCCCCGAAGCCCTCGACCTCTTGAAGGCCTGGGGCACCGGCCATCCCGGCGGCGTCGGCA
CCATCCACGCCGGCACCGCCATCGGCGCGCTGCGCCGTCTCGAACAGCTCATCCAGGAAGCCGTCGTCAC
CGTGCCGCGCGCGCTGATCGCCGAGACGATCGACATCGTCGCGGTGCTTTCGGGCCGCGGTTCGCAACGC
CGCCTGGCCGAACTCGCCCGCGTCGAGGGGCTCGGCCCTTCCGGCGACTACCAGATCAAACCGGCGGACG
CGGCGTCGGCGGTCTTTCCCCCAGCAACCCCAGACCTATCGGGAGATCCCGCATGA
 Primer design