SecReT4
Protein ID: 167647789
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3828
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4148041..4148373 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB0SV64
KEGG IDcak:Caul_3828
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.2e-24, Aligned region: 8..100
Protein Sequence: 110 a.a.     [Download]
>gi|167647789|ref|YP_001685452.1| conjugal transfer protein TrbC [Caulobacter sp. K31]
MIRHALRVRRQIATVASVTFVSLALAPAAYAAGSSMPWEAPLQSILQSIEGPVAKILAVIVIIVTGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4148041-4148373 Caulobacter sp. K31 chromosome, complete genome
ATGATCCGCCATGCCCTGCGCGTCCGTCGCCAAATCGCAACGGTCGCATCCGTCACCTTCGTCTCGCTGG
CGCTCGCGCCCGCCGCCTATGCGGCCGGTTCGTCGATGCCATGGGAAGCGCCGCTGCAATCGATCCTTCA
GTCGATCGAGGGGCCGGTCGCCAAAATCCTCGCGGTGATCGTCATCATCGTCACCGGTCTGACGCTCGCC
TTCGGCGACACGTCGGGCGGCTTTCGCCGGCTGATCCAGATCGTCTTCGGCCTGTCGATCGCGTTCGCCG
CCAGCTCCTTCTTCCTGTCGTTCTTCTCGTTCGGCGGCGGAGCGCTGGTCTGA
 Primer design