SecReT4
Protein ID: 167647791
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3830
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4148667..4151123 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDB0SV66
KEGG IDcak:Caul_3830
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 9.1e-35, Aligned region: 442..723
CagE_TrbE_VirB [PF03135], Evalue: 9e-12, Aligned region: 182..388
Protein Sequence: 818 a.a.     [Download]
>gi|167647791|ref|YP_001685454.1| conjugal transfer ATPase TrbE [Caulobacter sp. K31]
MMNLAEYRRTATRLADFLPWVALVGDGVVLNKDGSFQRSARFRGPDLDSAVPAELVAVAGRLNNAFRRLG
SGWSIFVEAQRHAAATYPSSLFADSAAALVDTERKADFEEAGAHFESSYFITFLYLPPAEDAARAENWLY
EGREQSGVDAREMMRGFVDRTDRVLQLVDGFMPECAWLDDAETLTYLHSTVSTKRHRVRVPETPIYLDAL
LADQPLTGGLEPRLGTSHLRVLTIVGFPTATTPGILDELNRLAFPYRWSTRAILLDKTDATRLLTKIRRQ
WFSKRKSIAAILKEVMTNEASVLVDTDAANKAADADLALQELGADYAGQAYVTATVTVWDDDPRIAAEKL
RLVEKVIQGRDFTAIPETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHFGAPP
LLYGKTEGSTPFRFSIHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGSQVFAFDFGGSIRAAALAMR
GDWHDLGGFLTEGSDTSVSLQPLARIHEVQERAWAADWIVAILMREGVPITPDVKELIWTAMTSLASAPI
SERTITGLAVLLQSNDLKQALRPYCVGGPYGRLLDAEHEHIGEASVQVFETEGLIGTDAAPAVLAYLFHR
IEDRLDGRPTLLIVDEGWLALDDEGFAGQLREWLKTLRKKNASVVFATQSLSDIDGSAIAPAIIESCQTR
LLLPNERAIEPQITAIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSDVALALCAASSKQHQ
ALIGDVLARSGPDHFLEAWLAECSLGWATELIPELTNVIPQTDPEVRP
 
Nucleotide Sequence: 2457 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4148667-4151123 Caulobacter sp. K31 chromosome, complete genome
ATGATGAACCTTGCCGAATACCGCCGCACCGCAACCCGTCTCGCCGATTTCCTGCCCTGGGTAGCGCTCG
TCGGTGACGGCGTCGTGCTCAACAAGGATGGCAGCTTCCAGCGGAGCGCGCGGTTTCGCGGTCCGGACCT
CGATAGCGCCGTGCCGGCCGAGCTGGTCGCCGTCGCCGGCCGCCTCAACAACGCTTTTCGTCGCCTCGGC
TCTGGCTGGTCGATCTTCGTCGAAGCACAGCGCCACGCCGCTGCCACCTATCCGTCGAGCCTGTTCGCCG
ACAGCGCGGCCGCGCTGGTGGATACCGAACGCAAAGCCGACTTCGAGGAAGCCGGCGCGCATTTCGAGTC
CAGCTACTTCATCACCTTCCTGTATCTGCCGCCAGCCGAGGACGCCGCGCGCGCCGAGAACTGGCTGTAT
GAAGGCCGCGAGCAATCCGGCGTCGATGCGCGCGAGATGATGCGGGGCTTTGTCGATCGCACCGACCGCG
TGCTCCAGCTCGTCGACGGCTTCATGCCCGAATGCGCCTGGCTCGATGACGCCGAGACGCTGACCTACCT
GCATTCCACCGTCTCGACCAAACGCCACCGCGTCCGGGTGCCCGAGACGCCGATCTATCTTGACGCGTTG
CTGGCCGATCAGCCGCTGACAGGCGGCCTCGAACCCCGGCTGGGGACATCGCATCTGCGCGTGCTGACCA
TCGTCGGTTTTCCGACTGCGACGACGCCCGGCATTCTCGATGAGCTGAACCGGCTGGCCTTCCCCTATCG
TTGGTCGACACGGGCGATCCTGCTCGACAAGACCGACGCCACCAGGTTGCTGACCAAGATCCGCCGGCAA
TGGTTTTCCAAACGCAAGTCGATCGCCGCCATCCTCAAGGAGGTGATGACCAACGAGGCCTCTGTCCTCG
TCGACACCGACGCCGCCAACAAGGCGGCCGATGCCGATCTCGCGCTTCAGGAGCTTGGCGCCGACTATGC
CGGTCAGGCCTACGTCACCGCCACCGTCACGGTGTGGGACGACGATCCGCGCATCGCCGCCGAGAAGCTG
CGGCTGGTCGAGAAGGTCATCCAGGGCCGCGACTTCACCGCGATACCCGAGACCATCAATGCCGTCGATG
CCTGGCTCGGCTCGCTGCCCGGACACGTCTACGCCAATGTCCGGCAACCGCCGATCTCGACGCTCAATCT
CGCCCACATGATCCCGCTCTCAGCGGTGTGGGCGGGGCCGGAACGGGATGAGCACTTTGGTGCGCCCCCC
TTGCTCTACGGCAAGACTGAAGGGTCCACCCCGTTCCGGTTTTCCATCCATGTCGGCGACGTCGGCCATA
CGCTCGTCGTCGGCCCGACCGGCGCCGGCAAGTCGGTATTGCTGGCGCTGATGGCGCTGCAGTTCCGGCG
CTATGCCGGAAGCCAAGTCTTCGCCTTTGACTTCGGAGGCTCGATCCGCGCCGCCGCGCTCGCCATGCGT
GGTGACTGGCACGATCTCGGCGGCTTCTTGACCGAGGGGTCGGACACCTCCGTCTCGCTTCAGCCGCTCG
CCCGCATTCATGAGGTGCAGGAGCGCGCCTGGGCCGCCGACTGGATCGTCGCCATCCTGATGCGCGAAGG
CGTGCCGATCACCCCTGACGTCAAGGAGCTGATCTGGACGGCGATGACATCGCTTGCCAGCGCGCCGATC
TCTGAGCGCACCATCACCGGGCTCGCCGTCCTGCTGCAATCCAATGACCTGAAACAGGCGCTGCGGCCCT
ATTGCGTTGGCGGTCCCTATGGCCGGCTGCTTGACGCCGAGCACGAGCATATCGGCGAGGCATCGGTCCA
GGTGTTCGAGACCGAGGGCCTGATCGGCACCGATGCGGCGCCGGCGGTGCTCGCCTATCTCTTTCATCGC
ATCGAGGACCGCCTCGACGGCCGGCCGACGCTGCTGATCGTCGATGAAGGCTGGCTCGCGCTTGATGACG
AGGGTTTTGCCGGCCAGCTCCGCGAGTGGCTTAAGACCCTGCGCAAGAAGAACGCCAGCGTCGTCTTCGC
CACGCAGTCGCTCTCCGACATCGACGGCTCGGCCATCGCGCCGGCGATCATCGAGAGCTGCCAGACGCGA
TTGCTGCTCCCCAACGAGCGAGCGATCGAACCGCAGATCACCGCCATTTACCGCCGCTTCGGGCTCAACG
ATCGCCAGATCGAGATCCTCGCGCGGGCGACGCCCAAGCGGGATTATTACTGCCAGTCACGGCGCGGCAA
TCGCCTGTTCGAGCTGGGACTGTCCGACGTGGCGCTGGCGCTCTGCGCCGCTTCCTCGAAACAGCACCAG
GCACTTATCGGCGACGTGCTTGCCCGCTCCGGCCCGGACCACTTCCTCGAAGCGTGGCTGGCCGAGTGCT
CGCTCGGCTGGGCGACCGAGCTGATCCCCGAACTCACCAATGTCATCCCCCAAACCGATCCGGAGGTACG
TCCATGA
 Primer design