SecReT4
Protein ID: 167647792
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3831
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4151120..4151890 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDB0SV67
KEGG IDcak:Caul_3831
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 4.3e-07, Aligned region: 23..55
Protein Sequence: 256 a.a.     [Download]
>gi|167647792|ref|YP_001685455.1| conjugal transfer protein TrbJ [Caulobacter sp. K31]
MTRLFFSRSRTARFAAVLLAAPIAFSPVMVQPAAAQWIVYDPTNYAQNVLTAARSLEQINNQITSLQNQA
QSLINQARNLTSLPFSSLQQLQQSVQRTQQLLAQAQGIALNVQQIDQAFKTTYGNASMSSSDQQLVAGAR
ERWQNTVGSLQDAMRVQAGVVGNIDTNRTQMSALVGQSQGATGALQVSQAGNQLLALQAQQLADLTAVVA
ANGRAQALQSAEQAAAAEQGREQRRRFLTPGAGYQPGNARMFPNGN
 
Nucleotide Sequence: 771 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4151120-4151890 Caulobacter sp. K31 chromosome, complete genome
ATGACCCGTCTGTTCTTCTCTCGCTCCCGCACCGCCCGCTTCGCGGCGGTGCTTCTCGCCGCCCCGATCG
CGTTTTCGCCCGTCATGGTACAGCCCGCCGCCGCGCAGTGGATCGTCTATGATCCGACCAACTACGCCCA
GAACGTGCTGACGGCGGCGCGGTCCCTGGAGCAGATCAACAATCAGATCACGTCGCTGCAGAACCAGGCG
CAGTCATTGATCAATCAGGCCCGCAACCTCACAAGCCTGCCGTTCTCGTCGCTGCAGCAGCTCCAGCAGT
CGGTCCAGCGCACGCAACAGCTCCTGGCCCAGGCGCAGGGGATCGCTCTCAACGTCCAGCAGATCGACCA
GGCGTTCAAGACCACCTACGGCAACGCGTCGATGTCGTCCTCCGACCAACAGCTCGTCGCCGGTGCGCGC
GAGCGTTGGCAAAACACCGTTGGCAGCCTTCAGGACGCGATGCGGGTCCAAGCCGGCGTCGTCGGCAACA
TCGACACCAATCGCACGCAGATGTCGGCGCTGGTTGGCCAGAGCCAGGGCGCGACCGGCGCGCTGCAAGT
GAGCCAGGCCGGCAACCAGCTTCTCGCCCTTCAGGCCCAGCAGCTCGCCGATCTCACCGCCGTCGTCGCC
GCCAACGGCCGGGCTCAGGCGTTGCAATCGGCCGAACAGGCCGCCGCCGCCGAACAGGGTCGCGAGCAAC
GCCGCCGCTTCTTGACGCCGGGCGCCGGCTACCAGCCCGGCAATGCCCGCATGTTCCCCAACGGCAACTA
A
 Primer design