SecReT4
Protein ID: 167647794
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3833
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4152296..4153660 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB0SV69
KEGG IDcak:Caul_3833
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 8.4e-54, Aligned region: 37..262
Protein Sequence: 454 a.a.     [Download]
>gi|167647794|ref|YP_001685457.1| conjugal transfer protein TrbL [Caulobacter sp. K31]
MGGTGVIDHFLEVFTRYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWSWGADDDIIARLVKKTLFIGVF
AYIIGNWNNLARIIFESFAGLGLKASGTGFTTADLLRPGKVAQTGLDAGRPLLESISGMMGYWSFFENFI
QIACMFFAWALVLLAFFVLAVQLFVTLIEFKLTTLAGFVLIPFGLFGKSAFMAERVLGNVISSGIKVLVL
AVIIGIGSTLFSEFTAGFGSATPSIDDAMAIVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAIGTGLA
AGGMVAAGAAAVGAVASGGAALAGGAAAAARGGAAMAGGASTAYSLGSAGQSGAAGVASGLGRVAEAGAS
AATSPLRRAASRAADSMKSSFSEGAKSTFEATGGSSTMGTIGGGPQEAEGAGASPAAQSGPPAWAKRMKR
SQGMTHAVQATAHAVRSGDSHGGGSSVNLSESDR
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4152296-4153660 Caulobacter sp. K31 chromosome, complete genome
ATGGGCGGCACCGGCGTCATCGACCACTTCCTGGAGGTCTTCACCCGCTACATCGATTCAGGCTTCGGCC
TGCTCGGTGGCGAGGTCGCCTTCATCGCCACGACACTGATCGTCATCGACGTGACGCTCGCAGCCCTGTT
CTGGAGCTGGGGCGCCGATGACGACATCATCGCGCGCCTGGTGAAGAAGACGCTGTTCATCGGCGTGTTC
GCCTACATCATCGGCAACTGGAATAACCTTGCCCGGATCATCTTCGAGAGCTTCGCCGGCCTCGGCCTGA
AGGCGTCGGGCACCGGCTTCACGACCGCCGATCTCCTGCGTCCCGGCAAGGTGGCGCAAACTGGTCTCGA
CGCCGGCAGGCCGCTGCTCGAATCCATCTCCGGCATGATGGGCTACTGGTCGTTCTTCGAGAACTTCATC
CAGATCGCCTGCATGTTCTTCGCCTGGGCGCTGGTGCTGCTGGCCTTCTTCGTTCTCGCCGTACAGCTCT
TCGTCACTTTGATCGAGTTCAAGCTGACGACGCTCGCAGGTTTCGTGCTGATCCCCTTCGGCCTATTCGG
CAAATCCGCCTTCATGGCCGAACGTGTGCTCGGCAACGTCATCTCGTCGGGCATCAAGGTGTTGGTGCTC
GCCGTCATCATCGGCATCGGCTCGACGCTCTTTTCCGAATTCACCGCCGGCTTCGGCAGCGCGACGCCAT
CGATCGATGACGCGATGGCCATCGTGCTCGCGGCCCTGTCGCTCCTCGGTCTCGGCATTTTCGGACCGGG
CATCGCCAACGGCCTCGTCTCCGGCGGACCGCAACTCGGAGCCGGCGCCGCTATCGGCACCGGCCTTGCT
GCCGGCGGCATGGTCGCCGCGGGCGCTGCCGCCGTTGGCGCTGTCGCATCTGGCGGCGCGGCCCTGGCCG
GCGGCGCCGCAGCAGCCGCACGTGGCGGCGCTGCGATGGCGGGCGGAGCATCGACCGCTTATAGCCTTGG
GTCCGCTGGTCAATCAGGCGCCGCAGGCGTCGCCTCGGGTCTTGGTCGCGTAGCCGAGGCCGGCGCCAGC
GCCGCAACGTCGCCGCTGCGCCGCGCCGCATCCCGCGCCGCCGACAGCATGAAGTCCAGCTTCTCCGAGG
GCGCCAAGTCGACCTTCGAGGCGACGGGCGGCTCCTCGACCATGGGCACGATCGGCGGGGGTCCGCAGGA
GGCTGAAGGCGCTGGCGCATCTCCCGCCGCCCAAAGTGGTCCGCCCGCCTGGGCCAAGCGCATGAAACGC
TCCCAGGGCATGACACACGCCGTTCAGGCGACCGCGCACGCCGTCCGCTCCGGCGACAGCCATGGCGGCG
GCTCTTCCGTCAACCTTTCCGAAAGCGACCGCTGA
 Primer design