SecReT4
Protein ID: 167647795
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3834
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4153660..4154343 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDB0SV70
KEGG IDcak:Caul_3834
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.5e-58, Aligned region: 21..224
Protein Sequence: 227 a.a.     [Download]
>gi|167647795|ref|YP_001685458.1| conjugal transfer protein TrbF [Caulobacter sp. K31]
MFKRPSTHYGKTPEPDTPYQRAGQIWDERIGSSRIQARNWRLMAFGSLFLSAGLSAALVWQSARGTIVPW
VVQVDRLGQSQAVAPAVADYRPTDPQMAWHLARFIEQVRSIPADPIIVRQNWLRAYDFTTDRGAMALNDY
ARSNDPFTKVGKQQIAVDVSSVIRASPDSFRVAWVERRYQDGALAETSRWTAILTVVVQIPRDADRLRAN
PLGIYVNAINWSRELGQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4153660-4154343 Caulobacter sp. K31 chromosome, complete genome
ATGTTCAAACGACCGTCCACCCATTACGGCAAGACACCCGAGCCGGACACGCCCTATCAGCGCGCCGGCC
AGATCTGGGACGAGCGCATCGGCTCCTCCCGCATCCAGGCCCGCAATTGGCGGCTGATGGCGTTCGGCTC
GCTGTTCCTGTCGGCAGGCCTTTCCGCCGCCCTGGTCTGGCAATCCGCGCGCGGCACCATCGTCCCATGG
GTGGTGCAGGTCGATCGCCTCGGCCAATCGCAGGCGGTCGCGCCCGCCGTTGCAGATTATCGTCCGACCG
ATCCGCAGATGGCCTGGCACCTGGCGCGCTTCATCGAGCAGGTTCGCTCGATCCCCGCCGATCCGATCAT
CGTGCGGCAGAACTGGCTTCGCGCCTACGACTTCACCACCGATCGCGGCGCGATGGCGCTCAACGATTAC
GCCCGCTCCAACGACCCGTTTACCAAGGTCGGCAAGCAGCAGATCGCCGTCGACGTCTCCAGCGTCATCC
GCGCATCCCCGGACTCGTTCCGTGTCGCATGGGTCGAGCGCCGCTATCAGGACGGCGCTCTCGCCGAGAC
CTCGCGGTGGACCGCCATCCTCACCGTCGTCGTGCAGATCCCGCGCGACGCCGATCGTCTCCGGGCCAAC
CCGCTCGGAATCTACGTCAACGCCATCAACTGGTCACGGGAGCTTGGGCAATGA
 Primer design