SecReT4
Protein ID: 167647796
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3835
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4154340..4155365 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB0SV71
KEGG IDcak:Caul_3835
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.1e-69, Aligned region: 110..334
Protein Sequence: 341 a.a.     [Download]
>gi|167647796|ref|YP_001685459.1| P-type conjugative transfer protein TrbG [Caulobacter sp. K31]
MKPYFRKAGDPAFRTSTFAALLLCTSALAGCATTQKPPEIAYDDAAPAVQTVDPPAPVTVVELPRPLPLP
GQMKPVEPSRRTPEAADPTARVNQANAAARIQPVRDGFINSMQVYPFTQGALYQVYTAVGQITDIALQPG
EQLVGSGPVAAGDTVRWIIGDTQSGSGATLQVHILVKPIRAELMTNLVINTNLRTYYMELRSTERTYMAS
VSWQYPQDQLIALRRQNAQAEATQPVASGVDLANVNFRYAIDGDRAPWRPLRAFDDGRQVFIEFPRGIAQ
GEMPPLFVVGPEGNTSELVNYRVRGNHMIVDRLFAAAELRFGSGDNQKRVRITRTDGRPAS
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4154340-4155365 Caulobacter sp. K31 chromosome, complete genome
ATGAAGCCGTATTTCCGTAAAGCCGGAGACCCGGCTTTCCGTACATCCACATTCGCGGCTTTGCTGCTTT
GCACATCGGCGCTGGCAGGCTGCGCCACCACGCAGAAGCCGCCGGAGATCGCGTATGACGATGCGGCCCC
GGCCGTGCAGACCGTCGATCCGCCTGCACCTGTCACCGTGGTTGAGCTCCCCCGGCCGCTGCCACTGCCC
GGCCAGATGAAGCCGGTAGAACCGTCGCGCCGCACGCCGGAGGCCGCCGATCCCACCGCCCGCGTCAACC
AGGCCAATGCCGCTGCCCGCATCCAGCCGGTGCGCGATGGCTTCATCAATTCGATGCAGGTCTATCCCTT
CACCCAAGGCGCGCTCTATCAAGTCTACACCGCCGTTGGGCAGATTACCGACATCGCGCTGCAGCCCGGC
GAGCAGCTCGTGGGCTCCGGCCCCGTCGCCGCCGGCGACACCGTGCGCTGGATCATCGGCGACACCCAGA
GCGGATCGGGCGCGACGCTGCAGGTCCATATTCTGGTGAAGCCTATCCGCGCCGAGCTGATGACCAACCT
CGTCATCAACACCAATCTGCGCACCTATTATATGGAGCTGCGCTCGACCGAGCGGACCTACATGGCGTCG
GTGTCCTGGCAGTATCCGCAAGACCAGCTCATCGCCTTGCGTCGTCAGAACGCGCAGGCCGAAGCGACGC
AGCCGGTCGCGAGCGGCGTCGATCTCGCCAACGTCAACTTCCGCTACGCGATCGATGGCGACCGCGCCCC
ATGGCGGCCGCTCCGCGCCTTCGACGACGGCCGTCAGGTCTTCATCGAGTTTCCGCGCGGCATCGCGCAA
GGGGAAATGCCGCCGCTCTTCGTCGTCGGACCGGAGGGCAATACCTCCGAACTGGTGAACTACCGCGTGC
GCGGCAATCATATGATCGTCGACCGCCTGTTTGCCGCCGCCGAGCTGCGCTTCGGCTCGGGCGACAACCA
GAAGCGCGTCCGCATCACCCGCACCGACGGGAGGCCTGCGTCGTGA
 Primer design