SecReT4
Protein ID: 167647797
T4SS name [ID]Trb [268]
Gene symbol-
Locus tagCaul_3836
StrainCaulobacter sp. K31
Repliconchromosome [GenBank: NC_010338] [Browse all T4SS(s) in this replicon]
Location [Strand]4155362..4156597 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDB0SV72
KEGG IDcak:Caul_3836
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.6e-61, Aligned region: 228..405
Protein Sequence: 411 a.a.     [Download]
>gi|167647797|ref|YP_001685460.1| conjugation TrbI family protein [Caulobacter sp. K31]
MSDINPRKEGDEVEEAQPLTGEPVGPGPMRLRTEAPRVTRLSRRVLAGLGLVASVGIGGALIYALQTRDS
GKPAEELYSTQNRTTADGLSGLPRDYTGPVLGPPLPGDLGRPILDAQKRGQPVPVPGAGPVTPGLTAEEQ
RRLQEIETARTSRLFSATETRSAAASTSTTTPLGADSSMPPQNLASLGLAPQPATPSAQDRQRAFLNAAP
DRRTVSSDRVAAPASPNILQAGAVISAALITGIRSDLPGQITAQVTENIYDSPTGRVLLVPQGTRLIGQY
DNGIGFGQRRILLVWNRLILPNGRSIVLERQPGADAEGYAGLEDGVDYHWWDLAKAAALSTLLGVGAELA
TDNNDRLVQAIRDGGQDTINDAGQQIVRRQLNIAPTLTIRPGFPVRVIVTRDIVLEPYGGS
 
Nucleotide Sequence: 1236 bp     [Download]
>gi|167643973|ref|NC_010338.1|:4155362-4156597 Caulobacter sp. K31 chromosome, complete genome
GTGAGCGACATCAATCCCCGGAAAGAGGGTGATGAAGTTGAAGAGGCCCAGCCGTTAACCGGCGAGCCGG
TCGGACCCGGCCCGATGCGCTTGCGCACCGAAGCGCCGCGCGTAACGCGGCTGTCGCGCCGTGTGCTCGC
GGGGCTAGGCTTGGTCGCCAGCGTCGGCATCGGCGGCGCGCTGATCTACGCGCTTCAGACCCGTGACAGC
GGCAAGCCGGCCGAGGAGCTGTACTCGACGCAGAACCGCACCACGGCGGACGGGCTCTCAGGTCTGCCCC
GCGACTATACCGGGCCGGTTCTTGGGCCTCCGCTGCCCGGCGATCTTGGCCGGCCGATCCTCGACGCGCA
GAAGCGCGGCCAGCCTGTGCCGGTCCCTGGCGCTGGCCCGGTTACCCCTGGCCTAACCGCCGAGGAACAG
CGCCGCCTTCAGGAGATCGAGACCGCACGGACCAGTCGGCTGTTCTCAGCGACGGAAACGCGATCAGCCG
CCGCATCAACCTCTACGACCACACCGTTGGGGGCCGATTCCTCTATGCCGCCGCAGAACCTCGCCAGCCT
CGGGCTTGCGCCTCAGCCGGCGACACCATCGGCGCAGGATCGACAACGCGCCTTCCTCAATGCCGCTCCC
GATCGCCGGACGGTCTCGTCCGACCGCGTTGCCGCGCCGGCATCGCCCAACATCCTGCAGGCTGGAGCTG
TCATCTCCGCCGCGCTCATAACCGGCATCCGCTCCGATCTGCCAGGGCAGATCACCGCCCAGGTGACGGA
GAACATTTACGACAGCCCGACCGGGCGCGTCCTGCTCGTACCGCAGGGCACGCGCCTGATCGGCCAATAC
GACAATGGCATCGGCTTCGGGCAACGCCGTATTCTGCTCGTTTGGAACCGCCTTATCCTGCCGAACGGGC
GCTCTATCGTGCTGGAGCGTCAACCTGGCGCGGATGCCGAGGGCTACGCCGGGCTTGAGGACGGCGTCGA
CTATCACTGGTGGGATCTCGCCAAGGCCGCTGCGCTTTCGACCTTGCTCGGCGTCGGTGCCGAACTCGCG
ACCGACAACAACGACCGGCTCGTGCAGGCCATTCGCGACGGCGGCCAGGACACCATTAACGACGCCGGCC
AGCAGATCGTCAGGCGTCAGCTCAATATCGCGCCCACGCTCACGATCAGGCCGGGCTTCCCGGTGCGGGT
GATCGTCACTCGCGATATTGTACTCGAACCATATGGAGGATCTTGA
 Primer design