SecReT4
Protein ID: 16803144
T4SS name [ID]Tra_Tn [653]
Gene symbol-
Locus taglmo1104
StrainListeria monocytogenes EGD-e
Repliconchromosome [GenBank: NC_003210] [Browse all T4SS(s) in this replicon]
Location [Strand]1138930..1139940 [-]
Producthypothetical protein
Component typeOrf14_Tn
UniProt IDQ8Y815
KEGG IDlmo:lmo1104
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 7.5e-62, Aligned region: 49..205
NLPC_P60 [PF00877], Evalue: 8.8e-30, Aligned region: 227..332
Protein Sequence: 336 a.a.     [Download]
>gi|16803144|ref|NP_464629.1| hypothetical protein lmo1104 [Listeria monocytogenes EGD-e]
MKLVKYFAIFGVVFSMFFSLLLFVTIVFAEEDDTRSSREEMIQQGGLNVSAEVLAHRPMVEKYCKEFGIE
EYVNYILAIMQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGCKYFSELLASAESNGCDINTVIQSYN
YGGGFINYVASNGKKYSYELAESFSKDKAGGVKVDYPNPIAIPVNGGWRYNYGNQFYVLLVSQYLTPVQF
DDETVQAIMNEALKYEGYPYVFGGSSPSTSFDCSGLTQWSYAVAGIQLPRVAQAQYDATQHIPLSEAKAG
DLVFFHSTYDAGSYVTHVGIYVGNNQMYHAGDPIGYTNLTDSYWQAHLIGAGRIIK
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|16802048|ref|NC_003210.1|:c1139940-1138930 Listeria monocytogenes EGD-e, complete genome
ATGAAGCTAGTAAAATACTTCGCCATCTTTGGAGTGGTTTTCTCTATGTTCTTTAGTCTGTTGCTATTTG
TAACTATCGTTTTTGCAGAGGAAGATGATACACGTAGTAGCAGAGAAGAAATGATTCAACAAGGTGGTCT
AAATGTATCAGCAGAGGTACTGGCACATAGACCAATGGTTGAGAAGTATTGTAAGGAGTTTGGCATTGAA
GAATACGTGAATTACATTCTAGCAATTATGCAGGTGGAATCTGGCGGAACTGCCGAAGATGTTATGCAAT
CCTCGGAATCTTTAGGACTTCCACCGAACAGCCTTAGTACAGAAGAATCCATCAAACAGGGTTGTAAATA
CTTTAGTGAGCTATTAGCTAGTGCTGAAAGCAACGGTTGTGATATTAACACAGTCATTCAATCCTACAAT
TATGGTGGTGGCTTTATCAACTATGTAGCTAGTAATGGAAAAAAGTACAGCTATGAACTTGCAGAATCTT
TTTCAAAGGATAAAGCAGGTGGTGTGAAAGTTGACTATCCTAACCCTATTGCAATTCCTGTAAATGGTGG
TTGGCGGTACAACTATGGAAATCAGTTTTATGTATTGCTTGTTTCTCAATACCTTACACCAGTCCAGTTT
GATGATGAAACCGTGCAAGCGATTATGAATGAAGCACTGAAATATGAGGGCTACCCTTATGTGTTTGGTG
GTTCTTCTCCCTCTACTTCTTTTGATTGTAGCGGATTGACACAATGGAGCTATGCAGTTGCAGGGATTCA
ACTTCCTAGAGTTGCACAAGCTCAATATGACGCAACACAGCATATCCCCTTATCAGAAGCCAAAGCAGGC
GATTTAGTTTTCTTCCACTCTACCTATGACGCTGGTAGTTACGTGACGCACGTTGGAATCTATGTTGGTA
ATAACCAAATGTACCACGCAGGTGATCCTATTGGTTATACCAACCTTACCGACAGTTATTGGCAAGCTCA
TTTAATTGGAGCTGGACGCATTATCAAATAG
 Primer design