SecReT4
Protein ID: 16803146
T4SS name [ID]Tra_Tn [653]
Gene symbol-
Locus taglmo1106
StrainListeria monocytogenes EGD-e
Repliconchromosome [GenBank: NC_003210] [Browse all T4SS(s) in this replicon]
Location [Strand]1142099..1144549 [-]
Producthypothetical protein
Component typeOrf16_Tn
UniProt IDQ8Y813
KEGG IDlmo:lmo1106
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-33, Aligned region: 468..763
Protein Sequence: 816 a.a.     [Download]
>gi|16803146|ref|NP_464631.1| hypothetical protein lmo1106 [Listeria monocytogenes EGD-e]
MAYPIKYIENNLVFNNDGECFAYYELIPYNYSFLSPDEKYQVHDNFRQLVAQSRDGKIHALQLATESSIR
ATQERSKLEVKGRLKEVAHRKIDEQTEALVSMIGDNQVDYRFFIGFKLLLNEQELSIQSVSQEIKKAVQE
FLNGVNHKLMGDFVSMSNAEIDRFSKMENLLESKISRRFKIRKLDKNDFGYIIEHIYGQTGTPYEEYEYH
LPKKYQDKEVLVKKYDILKPTRCLIDESQRYLKIIHEDETTYVAYFTINSIVGELDFPSSEIFYYQQQQF
TFPIDTSMNVEIVANKKALTTVRNKKKELKDLDSHAWESDNETSNNVIDALDSVNELETTLDQSKESMYK
LSYVVRVSAKDLDELKRRCDEVKDFYDDLSIKLVRPFGDMLGLHGEFIPASKRYINDYIQYVTSDFLAGL
GFGATQTLGEHEGIYVGYNLDTGKNVYLKPALASQGVKGSVTNALASAFIGSLGGGKSFSNNMLVYYAVL
FGGQAVIVDPKAERGKWKETLPEIAHEINIVNLTSDDENKGLLDPYVILSRKKDSESLAIDILTFLTGIS
SRDSDKFPVLRKAIRNVTQSEQRGLLLVIDELRKEDTSISNSIADHIESFVDYDFAHLLFSDGNVTQSIS
LEKQLNIIQVADLVLPDADTSFEEYTTMELLSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQ
GKTLSMKLVRAGRAMNAGVYFVTQNADDLLDEKMKNNIGLKFAFRSTDLVEIKKTLTFFGVDPEDENNQK
RLRELENGQCLISDLYGRVGVMQFHPIFEELLQAFDTRPPIRNEVE
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|16802048|ref|NC_003210.1|:c1144549-1142099 Listeria monocytogenes EGD-e, complete genome
ATGGCATATCCAATTAAATATATTGAAAATAATCTGGTCTTTAACAATGATGGCGAATGTTTCGCTTATT
ATGAACTGATACCTTACAATTACAGCTTTCTAAGTCCAGATGAAAAGTATCAAGTGCATGATAACTTCCG
CCAGCTTGTAGCTCAAAGCCGTGATGGAAAGATTCATGCGTTACAGCTTGCGACAGAATCCAGTATTAGA
GCGACACAGGAACGCTCAAAGCTGGAAGTGAAAGGACGACTAAAAGAAGTCGCTCACAGAAAAATTGATG
AACAAACCGAAGCGTTAGTTTCTATGATTGGCGACAATCAAGTAGACTATCGCTTTTTTATTGGATTCAA
GTTACTGCTGAATGAACAAGAACTTTCCATTCAATCGGTTAGTCAAGAAATCAAGAAAGCTGTGCAGGAA
TTTCTAAATGGTGTGAACCATAAGCTCATGGGCGACTTTGTGTCTATGAGTAATGCAGAGATTGACCGAT
TCTCAAAAATGGAAAATCTATTGGAAAGTAAAATCTCCAGACGGTTCAAAATCCGTAAGCTAGATAAAAA
TGATTTTGGTTATATCATTGAACATATCTACGGACAAACTGGTACACCTTACGAAGAATACGAATATCAT
TTACCTAAGAAATACCAGGATAAAGAAGTTCTAGTAAAGAAATATGATATCCTCAAACCTACTCGTTGTC
TAATTGATGAAAGCCAGCGTTACTTAAAAATCATTCATGAAGATGAAACCACTTATGTTGCCTACTTCAC
GATTAACTCAATTGTAGGCGAACTTGATTTTCCTAGTTCTGAAATCTTCTATTATCAACAGCAACAATTT
ACCTTTCCTATTGATACCAGCATGAATGTAGAAATTGTAGCCAACAAAAAAGCTCTTACAACCGTGAGAA
ACAAAAAGAAAGAATTAAAAGATTTAGATTCTCATGCTTGGGAAAGCGACAACGAAACAAGCAATAATGT
AATTGACGCTTTGGATTCCGTGAATGAATTAGAAACGACACTCGACCAAAGTAAAGAATCCATGTATAAA
CTTAGCTATGTTGTTCGTGTATCTGCAAAGGATCTCGACGAGTTGAAAAGGCGTTGTGATGAAGTCAAAG
ACTTTTACGACGACTTATCAATCAAACTCGTGCGTCCCTTTGGAGATATGTTAGGGCTACATGGCGAATT
TATCCCTGCCAGTAAACGGTACATCAATGACTATATTCAATACGTCACATCAGATTTTTTGGCTGGACTT
GGTTTTGGAGCGACACAAACCCTTGGCGAACATGAGGGTATTTATGTTGGGTACAATCTGGACACTGGAA
AGAATGTCTATCTGAAACCTGCCCTTGCTAGTCAAGGTGTCAAAGGTTCAGTTACCAATGCGTTAGCCAG
TGCATTTATTGGTTCATTGGGTGGTGGTAAATCATTCAGTAACAATATGCTTGTTTATTATGCGGTACTA
TTTGGTGGACAAGCGGTTATCGTTGACCCTAAAGCAGAACGTGGCAAATGGAAAGAAACACTACCAGAAA
TCGCCCACGAGATAAACATTGTCAACTTAACGAGTGATGATGAAAACAAAGGACTGCTTGACCCTTATGT
CATTTTGAGCCGTAAAAAGGATTCTGAAAGTTTAGCTATTGATATTCTAACGTTCCTTACTGGTATCTCC
AGTCGTGACAGTGATAAGTTTCCAGTGCTTAGAAAAGCGATTCGTAATGTAACCCAAAGTGAACAGCGAG
GGTTATTACTTGTTATTGATGAATTACGAAAAGAAGATACTTCTATCAGTAACAGCATAGCCGACCATAT
CGAAAGTTTTGTTGACTATGATTTTGCACACTTACTTTTTAGTGATGGAAATGTAACACAGTCTATCAGC
TTAGAAAAACAGCTGAACATTATTCAAGTTGCTGACCTCGTATTGCCAGACGCTGACACTAGCTTTGAAG
AATACACTACTATGGAATTATTGAGTGTTGCCATGCTGATTGTCATTAGTACCTTTGCATTAGACTTTAT
CCACACAGACCGCTCTATCTTTAAGATAGTTGACCTTGACGAAGCATGGTCTTTCTTACAGGTGGCACAA
GGTAAGACGTTATCTATGAAACTAGTTAGAGCTGGGCGTGCCATGAACGCTGGTGTTTACTTTGTTACGC
AAAATGCAGATGACCTTTTAGACGAAAAAATGAAGAACAATATCGGTCTAAAGTTTGCGTTTCGTTCCAC
TGACCTTGTGGAAATCAAAAAGACCCTGACATTCTTTGGAGTTGACCCAGAAGATGAAAACAATCAGAAA
CGACTACGAGAATTGGAAAACGGACAGTGTTTAATCTCTGACCTTTACGGTCGTGTGGGAGTAATGCAAT
TCCACCCTATTTTTGAAGAACTCTTACAAGCCTTTGATACTCGCCCACCTATTAGAAATGAGGTGGAATA
A
 Primer design