SecReT4
Protein ID: 16803149
T4SS name [ID]Tra_Tn [653]
Gene symbol-
Locus taglmo1109
StrainListeria monocytogenes EGD-e
Repliconchromosome [GenBank: NC_003210] [Browse all T4SS(s) in this replicon]
Location [Strand]1145723..1145944 [-]
Producthypothetical protein
Component typeOrf19_Tn
UniProt IDQ8Y810
KEGG IDlmo:lmo1109
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|16803149|ref|NP_464634.1| hypothetical protein lmo1109 [Listeria monocytogenes EGD-e]
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIALIAVGLVFNAGGVKDVLLNLFNRI
IGA
 
Nucleotide Sequence: 222 bp     [Download]
>gi|16802048|ref|NC_003210.1|:c1145944-1145723 Listeria monocytogenes EGD-e, complete genome
ATGAATTTTGGACAAAACTTATACAACTGGTTTTTGAGTAACGCACAATCCCTTGTCTTACTGGCAATCG
TAGTCATTGGACTATATTTGGGGTTCAAACGAGAGTTTTCAAAACTAATCGGATTCTTGATTATCGCACT
GATTGCCGTAGGACTGGTATTCAATGCAGGGGGCGTGAAAGACGTACTGCTGAACCTATTCAATCGAATC
ATTGGAGCTTAG
 Primer design